Clone Name | rbasd25j24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ECP_PANTR (P47780) Eosinophil cationic protein precursor (EC 3.1... | 31 | 2.9 | 2 | ECP_GORGO (P47778) Eosinophil cationic protein precursor (EC 3.1... | 30 | 5.0 | 3 | PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precurs... | 30 | 5.0 |
---|
>ECP_PANTR (P47780) Eosinophil cationic protein precursor (EC 3.1.27.-) (ECP)| (Ribonuclease 3) (RNase 3) Length = 160 Score = 30.8 bits (68), Expect = 2.9 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 5/78 (6%) Frame = +2 Query: 176 MNHFLQTPPN-----RVCNTSY*M*CKNEMQLKRRYTSNVINLKTKLAHVCAHQKHIQIC 340 + H PP RV N +Y CKN+ R +NV+N+ + C H + + C Sbjct: 40 IQHISLNPPRCTIAMRVIN-NYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNC 98 Query: 341 TDW*YITELIHIDLYGFG 394 + L+H DL G Sbjct: 99 HQSRFRVPLLHCDLINPG 116
>ECP_GORGO (P47778) Eosinophil cationic protein precursor (EC 3.1.27.-) (ECP)| (Ribonuclease 3) (RNase 3) Length = 160 Score = 30.0 bits (66), Expect = 5.0 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 5/78 (6%) Frame = +2 Query: 176 MNHFLQTPPN-----RVCNTSY*M*CKNEMQLKRRYTSNVINLKTKLAHVCAHQKHIQIC 340 + H PP RV N +Y CKN+ R +NV+N+ + C H + + C Sbjct: 40 IQHISLNPPRCTIAMRVIN-NYRWRCKNQNTFLRTTFANVVNVCGNQSIRCLHNRTLNNC 98 Query: 341 TDW*YITELIHIDLYGFG 394 + L+H DL G Sbjct: 99 HRSRFRVPLLHCDLINPG 116
>PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precursor (EC 3.1.1.4)| (Group X secretory phospholipase A2) (Phosphatidylcholine 2-acylhydrolase GX) (GX sPLA2) (sPLA2-X) Length = 155 Score = 30.0 bits (66), Expect = 5.0 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 416 KEIVKYCTKG*CNTYHVC-KQVHSSRCSSPTHEITWQRINANIHCGP*E 559 ++ + +C C+ + C + + CS T +WQ +N ++ CGP E Sbjct: 68 RDAIDWC----CHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAE 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,799,326 Number of Sequences: 219361 Number of extensions: 1599675 Number of successful extensions: 2921 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2915 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)