Clone Name | rbasd25j03 |
---|---|
Clone Library Name | barley_pub |
>CISY3_ARATH (Q9SJH7) Citrate synthase 3, peroxisomal precursor (EC 2.3.3.1)| Length = 509 Score = 33.1 bits (74), Expect = 0.37 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -1 Query: 472 LGQIATSNATRRRRAGSSL 416 LGQ+ATSNA+RRR AGSS+ Sbjct: 491 LGQVATSNASRRRLAGSSV 509
>NOTCH_XENLA (P21783) Neurogenic locus notch protein homolog precursor (XOTCH| protein) Length = 2524 Score = 32.0 bits (71), Expect = 0.82 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -1 Query: 229 GTCRFLHCGRYECTHLQFPSSSLRAYSVISCFSKKERGGGVIVDGVSVF 83 GTCR Y+CT L S ++ C S R GG VDGV+ + Sbjct: 230 GTCRQTDDTSYDCTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTY 278
>FCERA_HUMAN (P12319) High affinity immunoglobulin epsilon receptor| alpha-subunit precursor (FcERI) (IgE Fc receptor, alpha-subunit) (Fc-epsilon RI-alpha) Length = 257 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 220 RFLHCGRYECTHLQFPSSSLRAYSVISCFSKKERGGGVIVDGVSVFLRVH 71 +F G Y+C H Q S V S + + V+++G +FLR H Sbjct: 84 KFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCH 133
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 229 GTCRFLHCGRYECTHLQFPSSSLRAYSVISCFSKKERGGGVIVDGVSVF 83 GTCR +EC L S ++ C + + + GGV VDGV+ + Sbjct: 234 GTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTY 282
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.5 bits (62), Expect = 9.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = -1 Query: 229 GTCRFLHCGRYECTHLQFPSSSLRAYSVISCFSKKERGGGVIVDGVSVF 83 GTCR EC L S ++ C + K + GGV VDGV+ + Sbjct: 232 GTCRQTGDFTLECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTY 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,171,260 Number of Sequences: 219361 Number of extensions: 1512752 Number of successful extensions: 3576 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3576 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)