Clone Name | rbasd25g22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX1_COREF (Q8FMT1) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 30 | 3.5 | 2 | AGRN_RAT (P25304) Agrin precursor | 29 | 5.9 | 3 | COX1_CORGL (Q79VD7) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 29 | 7.7 |
---|
>COX1_COREF (Q8FMT1) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 580 Score = 30.0 bits (66), Expect = 3.5 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +1 Query: 292 LSCFGFWIVKTGFCGAITTLGPLSLGITSD*APTMFSATSDS 417 L+ FGFWI G G G L+ G +D TM+S SDS Sbjct: 122 LNAFGFWITTVG--GVAMLAGFLTPGGAADFGWTMYSPLSDS 161
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -2 Query: 393 CGSSVRCNPQGQWSKSCYSTTESCLDNPEAKARQIVDIGCIWADSCYHG 247 C S+ CNP G +S +C T C P +G + D C G Sbjct: 684 CPSTCHCNPHGSYSGTCDPATGQCSCRP--------GVGGLRCDRCEPG 724
>COX1_CORGL (Q79VD7) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 584 Score = 28.9 bits (63), Expect = 7.7 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 292 LSCFGFWIVKTGFCGAITTLGPLSLGITSD*APTMFSATSDS 417 L+ FGFWI G G G L+ G +D TM+S SD+ Sbjct: 122 LNAFGFWITTVG--GVAMLTGFLTPGGAADFGWTMYSPLSDA 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,458,850 Number of Sequences: 219361 Number of extensions: 1249987 Number of successful extensions: 3073 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3073 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)