Clone Name | rbasd25f02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAAD_RICPR (Q9ZD09) Probable aromatic acid decarboxylase (EC 4.1... | 29 | 3.7 | 2 | CHBG_SALTY (Q8ZPU1) UPF0249 protein chbG | 28 | 8.2 | 3 | CHBG_SALTI (Q8Z6H0) UPF0249 protein chbG | 28 | 8.2 |
---|
>PAAD_RICPR (Q9ZD09) Probable aromatic acid decarboxylase (EC 4.1.1.-)| Length = 189 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 156 CFLKIYGEVAHREEDSLVVFAAGLLVK 76 C +K +AH EDSL+ AAG+++K Sbjct: 89 CSMKTLASIAHSMEDSLISRAAGVVLK 115
>CHBG_SALTY (Q8ZPU1) UPF0249 protein chbG| Length = 252 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 156 CFLKIYGEVAHREEDSLVVFAAGLLVKTLCVYAXFXCYPDL 34 CFL+I AHR E SL V V + + + CYP L Sbjct: 185 CFLRILDASAHRGEASLEVMCHPAFVDNIIRQSAY-CYPRL 224
>CHBG_SALTI (Q8Z6H0) UPF0249 protein chbG| Length = 252 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 156 CFLKIYGEVAHREEDSLVVFAAGLLVKTLCVYAXFXCYPDL 34 CFL+I AHR E SL V V + + + CYP L Sbjct: 185 CFLRILDASAHRGEASLEVMCHPAFVDNIIRQSAY-CYPRL 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,227,898 Number of Sequences: 219361 Number of extensions: 481346 Number of successful extensions: 1415 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1392 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)