Clone Name | rbasd25d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ERBB2_CANFA (O18735) Receptor tyrosine-protein kinase erbB-2 pre... | 32 | 0.62 | 2 | ERBB2_MESAU (Q60553) Receptor tyrosine-protein kinase erbB-2 pre... | 32 | 0.62 | 3 | ERBB2_HUMAN (P04626) Receptor tyrosine-protein kinase erbB-2 pre... | 32 | 0.62 | 4 | ERBB2_RAT (P06494) Receptor tyrosine-protein kinase erbB-2 precu... | 28 | 6.8 |
---|
>ERBB2_CANFA (O18735) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) Length = 1259 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 143 SSCVFAALSFHHAGFCXLSCWAIVMLGXRASXAAPGPNG 27 S C+ A L F+H+G C L C A+V + P P G Sbjct: 250 SDCL-ACLHFNHSGICELHCPALVTYNTDTFESMPNPEG 287
>ERBB2_MESAU (Q60553) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) (NEU proto-oncogene) Length = 1254 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 143 SSCVFAALSFHHAGFCXLSCWAIVMLGXRASXAAPGPNG 27 S C+ A L F+H+G C L C A+V + P P G Sbjct: 250 SDCL-ACLHFNHSGICELHCPALVTYNTDTFESMPNPEG 287
>ERBB2_HUMAN (P04626) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) (NEU proto-oncogene) (Tyrosine kinase-type cell surface receptor HER2) (MLN 19) Length = 1255 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 143 SSCVFAALSFHHAGFCXLSCWAIVMLGXRASXAAPGPNG 27 S C+ A L F+H+G C L C A+V + P P G Sbjct: 250 SDCL-ACLHFNHSGICELHCPALVTYNTDTFESMPNPEG 287
>ERBB2_RAT (P06494) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) (NEU proto-oncogene) (Epidermal growth factor receptor-related protein) Length = 1257 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 143 SSCVFAALSFHHAGFCXLSCWAIVMLGXRASXAAPGPNG 27 S C+ A L F+H+G C L C A+V + P G Sbjct: 251 SDCL-ACLHFNHSGICELHCPALVTYNTDTFESMHNPEG 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,807,497 Number of Sequences: 219361 Number of extensions: 177829 Number of successful extensions: 479 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)