Clone Name | rbasd24n16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARODE_CHLMU (P56961) Shikimate biosynthesis protein aroDE [Inclu... | 30 | 1.8 |
---|
>ARODE_CHLMU (P56961) Shikimate biosynthesis protein aroDE [Includes:| 3-dehydroquinate dehydratase (EC 4.2.1.10) (3-dehydroquinase) (Type I DHQase); Shikimate dehydrogenase (EC 1.1.1.25)] Length = 478 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 17 LHTSLHXHLTPI*TARLAATLSYFHTSVAPS 109 LHTS H +T + T LA+++ Y+ +V+P+ Sbjct: 109 LHTSEHTDITQLYTQMLASSIDYYKLAVSPA 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,144,100 Number of Sequences: 219361 Number of extensions: 280965 Number of successful extensions: 682 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)