Clone Name | rbasd25b19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MYOC_FELCA (Q594P2) Myocilin precursor | 30 | 4.2 | 2 | COFD_METAC (Q8TST1) LPPG:FO 2-phopspho-L-lactate transferase (EC... | 30 | 5.5 | 3 | ARHGC_MOUSE (Q8R4H2) Rho guanine nucleotide exchange factor 12 (... | 29 | 9.3 |
---|
>MYOC_FELCA (Q594P2) Myocilin precursor| Length = 490 Score = 30.0 bits (66), Expect = 4.2 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = -3 Query: 322 TQESF*RKASASRREKKETSNSSK*FDAAWISYLRYSQRCQEQKKSFTSQVE 167 TQE R+ A RRE+++ + ++ +A++ + LR +E+K+ + E Sbjct: 99 TQEGLQRELGALRREREQLESQNRELEASYSNLLRDKSALEEEKRRLREENE 150
>COFD_METAC (Q8TST1) LPPG:FO 2-phopspho-L-lactate transferase (EC 2.7.1.-)| Length = 307 Score = 29.6 bits (65), Expect = 5.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 177 VKSSISLGEADRVVHKIKSAYLRGAASSETLVSRIAS 67 ++ S+ LG+ DR H I+S +RG S ++AS Sbjct: 82 IEESMKLGDRDRATHIIRSNLIRGGTSLTEATVKLAS 118
>ARHGC_MOUSE (Q8R4H2) Rho guanine nucleotide exchange factor 12| (Leukemia-associated RhoGEF) Length = 1543 Score = 28.9 bits (63), Expect = 9.3 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -1 Query: 249 NLTLHGSVILDTPNDVRNRRNLSLVKSSISLGEADRVVHKIKSAYLRGAASSE 91 ++T H S I+ +P+ N+ + S + +GE + VVH K LR E Sbjct: 164 SVTGHMSPIMTSPHSPGAAGNMERITSPVLVGEENNVVHNQKVEILRKMLQKE 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,602,146 Number of Sequences: 219361 Number of extensions: 1115693 Number of successful extensions: 2416 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2416 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)