Clone Name | rbasd24m19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF3A_MOUSE (P23116) Eukaryotic translation initiation factor 3 s... | 29 | 2.9 | 2 | CALD1_HUMAN (Q05682) Caldesmon (CDM) | 29 | 2.9 | 3 | CAN_CAEEL (P34308) Calpain clp-1 (EC 3.4.22.-) | 28 | 5.0 | 4 | CAC1B_HUMAN (Q00975) Voltage-dependent N-type calcium channel al... | 28 | 6.5 | 5 | ERF3_ARATH (O80339) Ethylene-responsive transcription factor 3 (... | 28 | 8.5 |
---|
>IF3A_MOUSE (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3| theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a) (p162 protein) (Centrosomin) Length = 1344 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -3 Query: 202 DKEKKKESTERDEGGQEVSXHQRVPQACRGRAXKRRPWAWEGPRRGPWSQGRVWR 38 DKEK +++ +R+E +++ + + RRP G RRGP + WR Sbjct: 1167 DKEKDRDNQDREENDKDLERDRDRERDGDREDRFRRPRDEGGWRRGPAEESSSWR 1221
>CALD1_HUMAN (Q05682) Caldesmon (CDM)| Length = 793 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 196 EKKKESTERDEGGQEVSXHQRVPQACRGRAXKRR 95 E+ K+ ER++G E+S H+++ + + RA R Sbjct: 236 EEPKQEEEREQGSDEISHHEKMEEEDKERAEAER 269
>CAN_CAEEL (P34308) Calpain clp-1 (EC 3.4.22.-)| Length = 780 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = -3 Query: 100 RRPWAWEGPRRGPWS-QGRVWRRIP 29 R PW E GPWS R WR +P Sbjct: 550 RNPWGNEQEWNGPWSDNSREWRSVP 574
>CAC1B_HUMAN (Q00975) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -3 Query: 187 KESTERDEGGQEVSXHQRVPQACRGRAXKRRPWAWEGPRRGP 62 +E+ ER+ HQ + C G +RR GPR GP Sbjct: 925 EEAAEREPRRHRAHRHQDPSKECAGAKGERRARHRGGPRAGP 966
>ERF3_ARATH (O80339) Ethylene-responsive transcription factor 3| (Ethylene-responsive element-binding factor 3) (EREBP-3) (AtERF3) Length = 225 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 118 RGRAXKRRPWA-WEGPRRGPWSQGRVW 41 R R ++RPW + R PW + RVW Sbjct: 27 RFRGVRKRPWGRFAAEIRDPWKKARVW 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.128 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,412,917 Number of Sequences: 219361 Number of extensions: 235947 Number of successful extensions: 686 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)