ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd25b06 |
|---|---|
| Clone Library Name | barley_pub |
>XTH8_ORYSA (Q76BW5) Xyloglucan endotransglycosylase/hydrolase protein 8| precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5) Length = 290 Score = 69.7 bits (169), Expect = 2e-12 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSRR 248 D LGTVAWAE YMSY+YC DGWRFP GFPAEC R+ Sbjct: 253 DGAELGTVAWAERNYMSYNYCADGWRFPQGFPAECYRK 290
>XTH20_ARATH (Q9FI31) Probable xyloglucan endotransglucosylase/hydrolase protein| 20 precursor (EC 2.4.1.207) (At-XTH20) (XTH-20) Length = 282 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECS 254 D K V WA+ KYM Y+YCTD RFP G P ECS Sbjct: 247 DFKGKNRVKWAQRKYMVYNYCTDKKRFPQGAPPECS 282
>XTH12_ARATH (Q9FKL9) Probable xyloglucan endotransglucosylase/hydrolase protein| 12 precursor (EC 2.4.1.207) (At-XTH12) (XTH-12) Length = 285 Score = 45.8 bits (107), Expect = 3e-05 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECS 254 ++ LG + W + YM Y+YCTD RFP G P EC+ Sbjct: 248 NSNQLGQLKWVQKDYMIYNYCTDFKRFPQGLPTECN 283
>XTH22_ARATH (Q38857) Xyloglucan endotransglucosylase/hydrolase protein 22| precursor (EC 2.4.1.207) (At-XTH22) (XTH-22) (Touch protein 4) Length = 284 Score = 44.3 bits (103), Expect = 7e-05 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAEC 257 D+ A + W + YM Y+YCTD RFP G P EC Sbjct: 247 DSTAQQRMRWVQRNYMIYNYCTDAKRFPQGLPKEC 281
>XTH21_ARATH (Q9ZV40) Probable xyloglucan endotransglucosylase/hydrolase protein| 21 precursor (EC 2.4.1.207) (At-XTH21) (XTH-21) Length = 305 Score = 43.9 bits (102), Expect = 1e-04 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSRRN 245 D+ + + W + K+M Y+YC D RF NG P EC+ +N Sbjct: 262 DSSSKKVLRWVQRKFMVYNYCKDKKRFSNGLPVECTAKN 300
>XTH13_ARATH (Q9FKL8) Putative xyloglucan endotransglucosylase/hydrolase protein| 13 precursor (EC 2.4.1.207) (At-XTH13) (XTH-13) Length = 284 Score = 43.9 bits (102), Expect = 1e-04 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -1 Query: 346 GTVAWAESKYMSYDYCTDGWRFPNGFPAECS 254 G + W + YM Y+YCTD RFP G P EC+ Sbjct: 252 GQMKWVQDDYMIYNYCTDFKRFPQGLPTECN 282
>XTH23_ARATH (Q38910) Probable xyloglucan endotransglucosylase/hydrolase protein| 23 precursor (EC 2.4.1.207) (At-XTH23) (XTH-23) Length = 286 Score = 43.5 bits (101), Expect = 1e-04 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAEC 257 D+ + W ++ YM Y+YCTD RFP G P EC Sbjct: 249 DSTGQEQMRWVQNNYMIYNYCTDAKRFPQGLPREC 283
>XTH24_ARATH (P24806) Xyloglucan endotransglucosylase/hydrolase protein 24| precursor (EC 2.4.1.207) (At-XTH24) (XTH-24) (Meristem protein 5) (MERI-5 protein) (MERI5 protein) (Endo-xyloglucan transferase) (Xyloglucan endo-1,4-beta-D-glucanase) Length = 269 Score = 43.1 bits (100), Expect = 2e-04 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECS 254 D+ + + W + YM Y+YCTD RFP G P EC+ Sbjct: 231 DSTSQARLKWVQKNYMIYNYCTDHRRFPQGAPKECT 266
>XTH17_ARATH (O80803) Probable xyloglucan endotransglucosylase/hydrolase protein| 17 precursor (EC 2.4.1.207) (At-XTH17) (XTH-17) Length = 282 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 328 ESKYMSYDYCTDGWRFPNGFPAECS 254 +SKYM Y+YCTD RFP G PAEC+ Sbjct: 258 QSKYMIYNYCTDKRRFPRGVPAECT 282
>BRU1_SOYBN (P35694) Brassinosteroid-regulated protein BRU1 precursor| Length = 283 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA + + W + +M Y+YC+D RFP G PAEC R Sbjct: 247 DAYSRRRLRWVQKYFMIYNYCSDLKRFPQGLPAECKR 283
>XTH16_ARATH (Q8LG58) Probable xyloglucan endotransglucosylase/hydrolase protein| 16 precursor (EC 2.4.1.207) (At-XTH16) (XTH-16) Length = 291 Score = 42.0 bits (97), Expect = 4e-04 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAECSR 251 W + +M YDYC+D RFP GFP EC + Sbjct: 261 WVQKYFMIYDYCSDLKRFPQGFPPECRK 288
>XTH25_ARATH (Q38907) Probable xyloglucan endotransglucosylase/hydrolase protein| 25 precursor (EC 2.4.1.207) (At-XTH25) (XTH-25) Length = 284 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 328 ESKYMSYDYCTDGWRFPNGFPAEC 257 + KYM Y+YCTD RFP GFP EC Sbjct: 259 QRKYMIYNYCTDTKRFPQGFPKEC 282
>XTH14_ARATH (Q9ZSU4) Xyloglucan endotransglucosylase/hydrolase protein 14| precursor (EC 2.4.1.207) (At-XTH14) (XTH-14) Length = 287 Score = 41.2 bits (95), Expect = 6e-04 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 346 GTVAWAESKYMSYDYCTDGWRFPNGFPAEC 257 G + W + +M Y+YCTD RFP G P EC Sbjct: 256 GKMMWVQRDFMIYNYCTDFKRFPQGLPKEC 285
>XTH19_ARATH (Q9M0D1) Probable xyloglucan endotransglucosylase/hydrolase protein| 19 precursor (EC 2.4.1.207) (At-XTH19) (XTH-19) Length = 277 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 328 ESKYMSYDYCTDGWRFPNGFPAECS 254 +SKYM Y+YC+D RFP G P ECS Sbjct: 253 QSKYMVYNYCSDKKRFPRGVPPECS 277
>XTH18_ARATH (Q9M0D2) Probable xyloglucan endotransglucosylase/hydrolase protein| 18 precursor (EC 2.4.1.207) (At-XTH18) (XTH-18) Length = 282 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 328 ESKYMSYDYCTDGWRFPNGFPAECS 254 +SKYM Y+YC D RFP G P ECS Sbjct: 258 QSKYMVYNYCNDKRRFPRGVPVECS 282
>XTH15_ARATH (Q38911) Probable xyloglucan endotransglucosylase/hydrolase protein| 15 precursor (EC 2.4.1.207) (At-XTH15) (XTH-15) Length = 289 Score = 40.4 bits (93), Expect = 0.001 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAECSR 251 W + +M Y+YC+D RFP GFP EC + Sbjct: 259 WVQKYFMIYNYCSDLKRFPRGFPPECKK 286
>XTH_SOYBN (Q39857) Probable xyloglucan endotransglucosylase/hydrolase| precursor (EC 2.4.1.207) (Fragment) Length = 295 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA + W KY Y+YCTD R+P+ P EC R Sbjct: 255 DAAQWRRLRWVRQKYTIYNYCTDTKRYPHISPPECKR 291
>XTH4_ARATH (Q39099) Xyloglucan endotransglucosylase/hydrolase protein 4| precursor (EC 2.4.1.207) (At-XTH4) (XTH-4) Length = 296 Score = 36.6 bits (83), Expect = 0.016 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA+ + W K+ Y+YCTD RFP PAEC R Sbjct: 257 DAEQWRRLKWVRMKWTIYNYCTDRTRFP-VMPAECKR 292
>XTH_BRAOB (Q6YDN9) Xyloglucan endotransglucosylase/hydrolase precursor (EC| 2.4.1.207) (BobXET16A) Length = 295 Score = 36.6 bits (83), Expect = 0.016 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA+ + W K+ Y+YCTD RFP PAEC R Sbjct: 256 DAEQYRRLKWVRMKWTIYNYCTDRTRFP-VMPAECRR 291
>XTH_TOBAC (P93349) Probable xyloglucan endotransglucosylase/hydrolase protein| precursor (EC 2.4.1.207) Length = 295 Score = 35.0 bits (79), Expect = 0.045 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA + W KY Y+YCTD R+P P EC++ Sbjct: 256 DALQYRRLRWVRQKYTIYNYCTDRKRYPT-LPPECTK 291
>XTHA_PHAAN (Q41638) Xyloglucan endotransglucosylase/hydrolase protein A| precursor (EC 2.4.1.207) (VaXTH1) Length = 292 Score = 35.0 bits (79), Expect = 0.045 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA +AW +KY Y+YCTD R+ + P EC+R Sbjct: 253 DAAQWQKLAWVRNKYTIYNYCTDRKRY-SQVPPECTR 288
>XTH10_ARATH (Q9ZVK1) Probable xyloglucan endotransglucosylase/hydrolase protein| 10 precursor (EC 2.4.1.207) (At-XTH10) (XTH-10) Length = 299 Score = 34.3 bits (77), Expect = 0.077 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAECS 254 W ++ YDYC D RF N P ECS Sbjct: 269 WVRKYHLIYDYCQDYGRFNNKLPKECS 295
>XTH5_ARATH (Q9XIW1) Probable xyloglucan endotransglucosylase/hydrolase protein| 5 precursor (EC 2.4.1.207) (At-XTH5) (XTH-5) Length = 293 Score = 34.3 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA + W +Y Y+YCTD RFP P EC R Sbjct: 254 DANQYKRLKWVRKRYTIYNYCTDRVRFPVP-PPECRR 289
>XTH1_LYCES (Q40144) Probable xyloglucan endotransglucosylase/hydrolase 1| precursor (EC 2.4.1.207) (LeXTH1) Length = 296 Score = 33.1 bits (74), Expect = 0.17 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA + W KY Y+YCTD R+P P EC++ Sbjct: 257 DALQYRRLRWVRQKYTVYNYCTDKARYPVP-PPECTK 292
>XTHB_PHAAN (Q8LNZ5) Probable xyloglucan endotransglucosylase/hydrolase protein| B precursor (EC 2.4.1.207) (VaXTH2) Length = 293 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAECSR 251 W K+ Y+YCTD R+P P EC R Sbjct: 263 WVRQKFTIYNYCTDRTRYPQ-LPPECRR 289
>XTH7_ARATH (Q8LER3) Probable xyloglucan endotransglucosylase/hydrolase protein| 7 precursor (EC 2.4.1.207) (At-XTH7) (XTH-7) Length = 293 Score = 33.1 bits (74), Expect = 0.17 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAECS 254 W +M YDYCTD RFP P ECS Sbjct: 265 WVRVNHMVYDYCTDKSRFPVP-PPECS 290
>XTH8_ARATH (Q8L9A9) Probable xyloglucan endotransglucosylase/hydrolase protein| 8 precursor (EC 2.4.1.207) (At-XTH8) (XTH-8) Length = 292 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 337 AWAESKYMSYDYCTDGWRFPNGFPAECS 254 AW + + YDYC D RFP P ECS Sbjct: 261 AWVQRNLVVYDYCKDSERFPT-LPWECS 287
>XTH6_ARATH (Q8LF99) Probable xyloglucan endotransglucosylase/hydrolase protein| 6 precursor (EC 2.4.1.207) (At-XTH6) (XTH-6) Length = 292 Score = 31.6 bits (70), Expect = 0.50 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAEC 257 W +M YDYCTD RFP P EC Sbjct: 266 WVRVNHMVYDYCTDRSRFPVP-PPEC 290
>XTH9_ARATH (Q8LDW9) Xyloglucan endotransglucosylase/hydrolase protein 9| precursor (EC 2.4.1.207) (At-XTH9) (XTH-9) Length = 290 Score = 31.2 bits (69), Expect = 0.65 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 334 WAESKYMSYDYCTDGWRFPNGFPAEC 257 W + +M YDYC D RFP P EC Sbjct: 260 WVRANHMIYDYCFDATRFP-VTPLEC 284
>XTH2_ARATH (Q9SV60) Putative xyloglucan endotransglucosylase/hydrolase protein| 2 precursor (EC 2.4.1.207) (At-XTH2) (XTH-2) Length = 292 Score = 31.2 bits (69), Expect = 0.65 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -1 Query: 325 SKYMSYDYCTDGWRFPNGFPAEC 257 +KYM+YDYC+D R+P P+EC Sbjct: 267 AKYMTYDYCSDRPRYPVP-PSEC 288
>XTH26_ARATH (Q9SVV2) Putative xyloglucan endotransglucosylase/hydrolase protein| 26 precursor (EC 2.4.1.207) (At-XTH26) (XTH-26) Length = 292 Score = 31.2 bits (69), Expect = 0.65 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 319 YMSYDYCTDGWRFPNGFPAECSRR 248 +M YDYC D RF P ECS++ Sbjct: 267 FMIYDYCKDTNRFKGVMPPECSKK 290
>XTH3_ARATH (Q9LJR7) Probable xyloglucan endotransglucosylase/hydrolase protein| 3 precursor (EC 2.4.1.207) (At-XTH3) (XTH-3) Length = 290 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 325 SKYMSYDYCTDGWRFPNGFPAEC 257 SKYM+YDYCTD ++ P EC Sbjct: 268 SKYMNYDYCTDRSKYQTP-PREC 289
>XTH1_ARATH (Q9SV61) Putative xyloglucan endotransglucosylase/hydrolase protein| 1 precursor (EC 2.4.1.207) (At-XTH1) (XTH-1) Length = 295 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -1 Query: 322 KYMSYDYCTDGWRFPNGFPAECSRRN 245 KYM+YDYC+D RF + P+EC N Sbjct: 271 KYMNYDYCSDKVRF-HVPPSECKWNN 295
>XTH11_ARATH (Q9SMP1) Probable xyloglucan endotransglucosylase/hydrolase protein| 11 precursor (EC 2.4.1.207) (At-XTH11) (XTH-11) Length = 267 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 331 AESKYMSYDYCTDGWRFPNGFPAEC 257 A Y+ YDYC+D R+P P EC Sbjct: 240 ARKTYLDYDYCSDRQRYPK-VPQEC 263
>RL21_STAAU (Q93EP0) 50S ribosomal protein L21| Length = 102 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSXRKKGHRQP 91
>XTH33_ARATH (Q8LC45) Probable xyloglucan endotransglucosylase/hydrolase protein| 33 precursor (EC 2.4.1.207) (At-XTH33) (XTH-33) Length = 310 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 349 LGTVAWAESKYMSYDYCTDGWRFPNGFPAECS 254 + + WA K M Y YC+D R+ PAEC+ Sbjct: 280 INAMDWARRKLMFYSYCSDKPRY-KVMPAECN 310
>RL21_STAAW (Q7A0Q2) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>RL21_STAAS (Q6G8S2) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>RL21_STAAR (Q6GG57) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>RL21_STAAN (Q7A583) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>RL21_STAAM (Q99TK6) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>RL21_STAAC (Q5HFB6) 50S ribosomal protein L21| Length = 102 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R ++ + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQP 91
>REXO4_XENLA (Q91560) RNA exonuclease 4 (EC 3.1.-.-) (Exonuclease XPMC2)| (Prevents mitotic catastrophe 2 protein) Length = 421 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 213 EGRKKKVMMDQLRREHSAGKPLGKRQP 293 +G+K+K+M + EH KP G+ QP Sbjct: 149 KGKKRKIMAEATDTEHQGKKPQGEAQP 175
>RL21_STAHJ (Q4L6Z3) 50S ribosomal protein L21| Length = 102 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G T T T ++GR KK+ + +R + + G RQP Sbjct: 55 GATVTATVNKQGRGKKITVFTYKRRKDSKRKKGHRQP 91
>XTH_WHEAT (Q41542) Probable xyloglucan endotransglucosylase/hydrolase| precursor (EC 2.4.1.207) Length = 293 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 361 DAKALGTVAWAESKYMSYDYCTDGWRFPNGFPAECSR 251 DA +AW ++ Y+YCTD R+ P EC R Sbjct: 254 DAAQYRRLAWVRKEHTIYNYCTDHDRYAAMAP-ECKR 289
>RBN_COLP3 (Q489A5) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 303 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -1 Query: 286 RFPNGFPAECSRRN*SIITFFFLPSLLVVGVLVCPFD--WSETDTRWLISHVSTFY 125 ++ GF A S+ + I+F FL +LL++ + F+ W TD R I+ + ++ Sbjct: 93 QYLTGFVANASKMSAVAISFLFLAALLLISSIDNTFNKIWRVTDKRRTITSFAMYW 148
>LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)| Length = 1799 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 209 PRRWCSCLSIRLERDGHTLAHFPCKYILP 123 P +W L + ++R G AH PC ++LP Sbjct: 635 PEQWAE-LELMVQRPGPVSAHSPCGHVLP 662
>SPN1_MOUSE (Q80W37) Snurportin-1 (RNA U transporter 1)| Length = 358 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 164 RLAPIEWTNKNTNDEEGRKEEESDD 238 RLA +WT + +EE +K+EE D Sbjct: 64 RLAEDDWTGMESGEEENKKDEEEMD 88
>RL21_STAS1 (Q49Y85) 50S ribosomal protein L21| Length = 102 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G + T T +++GR KK+ + +R + + G RQP Sbjct: 55 GASVTATVQKQGRGKKITVFTYKRRKDSKRKKGHRQP 91
>MYST3_RAT (Q5TKR9) Histone acetyltransferase MYST3 (EC 2.3.1.48) (EC 2.3.1.-)| (MYST protein 3) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3) (Monocytic leukemia zinc finger protein) (Monocytic leukemia zinc finger homolog) Length = 1998 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 149 EPTCVRLAPIEWTNKNTNDEEGRKEEESDDG 241 +P C+R P+ +N ++EE +EE+DDG Sbjct: 768 DPECLRWTPVIVSNSVVSEEE---DEEADDG 795
>RL21_STAES (Q8CS87) 50S ribosomal protein L21| Length = 102 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G + T T ++GR KK+ + +R + + G RQP Sbjct: 55 GASVTATVNKQGRGKKITVFTYKRRKDSKRKKGHRQP 91
>RL21_STAEQ (Q5HNQ4) 50S ribosomal protein L21| Length = 102 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 183 GQTRTPTTRREGRKKKVMMDQLRREHSAGKPLGKRQP 293 G + T T ++GR KK+ + +R + + G RQP Sbjct: 55 GASVTATVNKQGRGKKITVFTYKRRKDSKRKKGHRQP 91
>Y281_BUCAI (P57368) Hypothetical transport protein BU281| Length = 307 Score = 27.3 bits (59), Expect = 9.4 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -1 Query: 265 AECSRR--N*SIITFFFLPSLLVVGVLVCPFDWSETDTRWLIS--HVSTF 128 +EC ++ N S+ITF LPSLL G+L+ + T W I H++TF Sbjct: 168 SECQKKCLNVSVITFNALPSLL-SGILL-------STTSWFIESPHINTF 209
>ALGK_PSEAE (P96956) Alginate biosynthesis protein algK precursor| Length = 475 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 222 KKKVMMDQLRREHSAGKPLGKRQPSV 299 K+KV+++QLR + AG+ G+R SV Sbjct: 221 KQKVLLEQLRAAYKAGRVPGERVDSV 246
>SPN1_RAT (Q68FP5) Snurportin-1 (RNA U transporter 1)| Length = 358 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 164 RLAPIEWTNKNTNDEEGRKEEESDD 238 RLA +WT + +EE +K+EE D Sbjct: 64 RLAEDDWTGMESGEEEKKKDEEEMD 88
>LAMB2_RAT (P15800) Laminin beta-2 chain precursor (S-laminin) (Laminin chain| B3) Length = 1801 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 209 PRRWCSCLSIRLERDGHTLAHFPCKYILP 123 P +W L + ++R G AH PC ++LP Sbjct: 635 PEQWAE-LELVVQRPGPVSAHSPCGHVLP 662 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,142,849 Number of Sequences: 219361 Number of extensions: 767445 Number of successful extensions: 2373 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 2301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2370 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
