Clone Name | rbasd25b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HS12B_HUMAN (Q96MM6) Heat shock 70 kDa protein 12B | 30 | 5.4 | 2 | K1219_HUMAN (Q86X10) Protein KIAA1219 | 30 | 5.4 | 3 | YO078_YEAST (Q08236) Protein YOL078W | 30 | 7.1 |
---|
>HS12B_HUMAN (Q96MM6) Heat shock 70 kDa protein 12B| Length = 686 Score = 30.4 bits (67), Expect = 5.4 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 303 HSRTFLAQSGIGFIWA 350 HSRTFL +SG+G +WA Sbjct: 293 HSRTFLVESGVGELWA 308
>K1219_HUMAN (Q86X10) Protein KIAA1219| Length = 1494 Score = 30.4 bits (67), Expect = 5.4 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 601 LCFPVLCSSI-DDTRCFCCEHNGIKIVHPFF 512 +C PVL S I + FCC+ GI +V P+F Sbjct: 555 VCHPVLASVILNSPPLFCCDLKGIDVVVPYF 585
>YO078_YEAST (Q08236) Protein YOL078W| Length = 1176 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 483 KSSRRPLYVSKNGCTIFIPLCSQQKQRVSSIEEHNTGKHN 602 KS++ L V +NG + PL S + + ++H +GKH+ Sbjct: 118 KSAKNTLIVEENGTLRYNPLNSSASNSLLNDDDHTSGKHH 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,107,750 Number of Sequences: 219361 Number of extensions: 2030877 Number of successful extensions: 5354 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5354 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)