| Clone Name | rbasd24l23 |
|---|---|
| Clone Library Name | barley_pub |
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/49 (85%), Positives = 42/49 (85%), Gaps = 5/49 (10%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPS-----DGDPTDEKMVMEMGI 1 EQVDEWNND DRKN HGAGMVPYVLLRPS DGDPTDEKMVMEMGI Sbjct: 882 EQVDEWNNDPDRKNRHGAGMVPYVLLRPSDGDPTDGDPTDEKMVMEMGI 930
>LOX22_HORVU (Q8GSM3) Lipoxygenase 2.2, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:2) Length = 932 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPSDGDPTDEKMVMEMGI 1 EQV+EWN D R+N HGAG+VPYVLLRP +G+P D K VMEMGI Sbjct: 883 EQVEEWNKDDSRRNRHGAGVVPYVLLRPLNGNPMDAKTVMEMGI 926
>LOX5_ORYSA (Q7XV13) Putative lipoxygenase 5 (EC 1.13.11.12)| Length = 899 Score = 34.7 bits (78), Expect = 0.075 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPSDG 40 E+++ N D R+N GAG++PY L+ PS G Sbjct: 855 EEIERRNADPSRRNRCGAGVLPYELMAPSSG 885
>LOX6_ORYSA (Q8H016) Probable lipoxygenase 6 (EC 1.13.11.12)| Length = 918 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPS 46 E ++ N D RKN GAG++PY LL PS Sbjct: 874 ETIERRNADHGRKNRCGAGVLPYELLAPS 902
>LOX23_HORVU (Q8GSM2) Lipoxygenase 2.3, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:3) Length = 896 Score = 33.1 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 126 VDEWNNDXDRKNXHGAGMVPYVLLRP 49 +D NN+ + KN GAG+VPY LL+P Sbjct: 854 IDMRNNNPENKNRCGAGIVPYELLKP 879
>LOXC_ARATH (P38418) Lipoxygenase, chloroplast precursor (EC 1.13.11.12)| Length = 896 Score = 30.0 bits (66), Expect = 1.9 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -3 Query: 126 VDEWNNDXDRKNXHGAGMVPYVLLRPSDGDPTDEKMVMEMGI 1 +DE N + KN GAG+V Y LL+ PT E V MG+ Sbjct: 854 IDERNVNITLKNRAGAGVVKYELLK-----PTSEHGVTGMGV 890
>LOXC1_ORYSA (P38419) Lipoxygenase 7, chloroplast precursor (EC 1.13.11.12)| Length = 924 Score = 29.3 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 126 VDEWNNDXDRKNXHGAGMVPYVLLRP 49 +D N D KN GAG++PY L++P Sbjct: 882 IDGRNKDRKLKNRCGAGILPYQLMKP 907
>LOXC2_ORYSA (Q84YK8) Probable lipoxygenase 8, chloroplast precursor (EC| 1.13.11.12) Length = 941 Score = 29.3 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 126 VDEWNNDXDRKNXHGAGMVPYVLLRP 49 +D N D KN GAG++PY L++P Sbjct: 899 IDGRNKDRKLKNRCGAGILPYQLMKP 924
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPS 46 E++ + NND +N +G +PY LL PS Sbjct: 822 EKLTQRNNDESLRNRYGPVKMPYTLLYPS 850
>LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12)| Length = 861 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPS 46 +++ + NND +N HG +PY LL PS Sbjct: 817 KKLTQRNNDEKLRNRHGPVEMPYTLLYPS 845
>LOX1_ARATH (Q06327) Lipoxygenase 1 (EC 1.13.11.12)| Length = 859 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 132 EQVDEWNNDXDRKNXHGAGMVPYVLLRPS 46 + +DE N+D KN G +PY LL PS Sbjct: 815 KNIDERNDDETLKNRTGLVKMPYTLLFPS 843 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,186,559 Number of Sequences: 219361 Number of extensions: 239071 Number of successful extensions: 533 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)