Clone Name | rbasd25a15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | C1QT8_HUMAN (P60827) Complement C1q tumor necrosis factor-relate... | 30 | 2.0 | 2 | SP2G_CLOAB (Q45832) Probable sporulation sigma-E factor processi... | 28 | 4.5 | 3 | ESR2_SPAAU (Q9W6M2) Estrogen receptor beta (ER-beta) | 28 | 5.9 |
---|
>C1QT8_HUMAN (P60827) Complement C1q tumor necrosis factor-related protein 8| precursor Length = 262 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 287 WPARPRGPGIRGATRCWLPGPVRRLPEPDV 198 WP PR P + W PGP R+ + D+ Sbjct: 18 WPGLPRRPCVHCCRPAWPPGPYARVSDRDL 47
>SP2G_CLOAB (Q45832) Probable sporulation sigma-E factor processing peptidase| (EC 3.4.23.-) Length = 266 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -2 Query: 148 KAFVAFSKPDLTFLSGSNYFSVSCTIVVRAFHLLVAGLCFFIFLVXT 8 K AF + F S F++ V+ + ++ AGLCFFI L T Sbjct: 64 KIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAGLCFFIELNNT 110
>ESR2_SPAAU (Q9W6M2) Estrogen receptor beta (ER-beta)| Length = 559 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 284 PARPRGPGIRGATRCWLPGPVRRLPEP 204 PARP PG G T W P EP Sbjct: 532 PARPHSPGTSGPTNTWTPSCTGGRGEP 558 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,925,251 Number of Sequences: 219361 Number of extensions: 600212 Number of successful extensions: 1799 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1799 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)