Clone Name | rbasd24l11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YHJG_ECOLI (P37645) Hypothetical protein yhjG | 32 | 1.7 | 2 | NOD_DROME (P18105) Kinesin-like protein Nod | 30 | 4.8 | 3 | RPC1_GIALA (P25202) DNA-directed RNA polymerase III largest subu... | 30 | 8.2 |
---|
>YHJG_ECOLI (P37645) Hypothetical protein yhjG| Length = 691 Score = 32.0 bits (71), Expect = 1.7 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 2/98 (2%) Frame = -2 Query: 651 LTVSQTTPAASNANKQREGAEIITGAEACYAHSKELLKGLGFPGGVMPLRGLXECGLVRX 472 L S+ T + A+K++ G + + G +A ++ E L G G GG++ LRG Sbjct: 200 LPFSEVTGSKGKADKEKVG-DYVFGLKAQGRYNGEPLTGTGKIGGMLALRG--------- 249 Query: 471 TGYVXMRQGKPY--EHHFRATGTRVRYDA*VTAYVEEG 364 +G P+ + FR+ TRV +D V ++ G Sbjct: 250 -------EGTPFPVQADFRSGNTRVAFDGVVNDPMKMG 280
>NOD_DROME (P18105) Kinesin-like protein Nod| Length = 666 Score = 30.4 bits (67), Expect = 4.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 22 LIEANTQNRKDTSIHARDNASRTHSCQCVHGRSFVSHTR 138 ++E T+NR+ + N+SR+H+ +H +S H+R Sbjct: 183 ILELGTRNRRVRPTNMNSNSSRSHAIVTIHVKSKTHHSR 221
>RPC1_GIALA (P25202) DNA-directed RNA polymerase III largest subunit (EC| 2.7.7.6) Length = 1741 Score = 29.6 bits (65), Expect = 8.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 525 PGGVMPLRGLXECGLVRXTGYVXMRQGKPYEHHFRATGTRVRY 397 PGGV P++ + G TG + +GK +G RV + Sbjct: 383 PGGVQPVKNKTDSGTKEGTGIIDRLKGKAGRFRSNLSGKRVNF 425 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,803,050 Number of Sequences: 219361 Number of extensions: 960963 Number of successful extensions: 2825 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2822 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)