Clone Name | rbasd24l04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6) | 28 | 8.8 |
---|
>HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6)| Length = 5635 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 51 NNSTYYTSYNLXTI*VQALXLTPS-HYRQYNNQYRCY 158 N T Y+SYNL P HYRQY++ Y Y Sbjct: 5362 NYGTQYSSYNLARFSPVRNNYQPQQHYRQYSHLYSSY 5398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,091,727 Number of Sequences: 219361 Number of extensions: 272713 Number of successful extensions: 591 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)