Clone Name | rbasd24j19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BSN_MOUSE (O88737) Bassoon protein | 29 | 2.4 | 2 | BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231) | 29 | 2.4 | 3 | SODM_BOVIN (P41976) Superoxide dismutase [Mn], mitochondrial pre... | 28 | 7.1 |
---|
>BSN_MOUSE (O88737) Bassoon protein| Length = 3941 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 196 FISIYSPVDVPSGLDNPPXSG 134 F+S+YSP + PSG P SG Sbjct: 1167 FMSLYSPTETPSGSSTTPSSG 1187
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 196 FISIYSPVDVPSGLDNPPXSG 134 F+S+YSP + PSG P SG Sbjct: 1157 FMSLYSPTETPSGSSTTPSSG 1177
>SODM_BOVIN (P41976) Superoxide dismutase [Mn], mitochondrial precursor (EC| 1.15.1.1) Length = 222 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 167 HIYRTINRNEQIDYLYKX-NLTNWQNVTAR 253 H Y +N + DYL N+ NW+NVTAR Sbjct: 187 HAYYLQYKNVRPDYLKAIWNVINWENVTAR 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,284,608 Number of Sequences: 219361 Number of extensions: 692832 Number of successful extensions: 939 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)