Clone Name | rbasd24i04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | METK_TROWT (Q83GE4) S-adenosylmethionine synthetase (EC 2.5.1.6)... | 28 | 4.6 | 2 | METK_TROW8 (Q83HT7) S-adenosylmethionine synthetase (EC 2.5.1.6)... | 28 | 4.6 | 3 | IL28_MOUSE (Q8CGK6) Interleukin-28 precursor (Interferon lambda)... | 28 | 7.9 |
---|
>METK_TROWT (Q83GE4) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 395 Score = 28.5 bits (62), Expect = 4.6 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 11/58 (18%) Frame = -1 Query: 257 RGGEET-DGRGCA---GEISQ-------GVLRKPSLLLSRTSPDAGLEDGICSHQSQL 117 R G ET G G GE+S G++RK L + TS DAG++ CS Q + Sbjct: 36 RAGIETIAGNGVVHVFGEVSNPDSVDIPGIIRKTILDIGYTSEDAGIDGNTCSIQESI 93
>METK_TROW8 (Q83HT7) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 395 Score = 28.5 bits (62), Expect = 4.6 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 11/58 (18%) Frame = -1 Query: 257 RGGEET-DGRGCA---GEISQ-------GVLRKPSLLLSRTSPDAGLEDGICSHQSQL 117 R G ET G G GE+S G++RK L + TS DAG++ CS Q + Sbjct: 36 RAGIETIAGNGVVHVFGEVSNPDSVDIPGIIRKTILDIGYTSEDAGIDGNTCSIQESI 93
>IL28_MOUSE (Q8CGK6) Interleukin-28 precursor (Interferon lambda) (IFN-lambda)| Length = 193 Score = 27.7 bits (60), Expect = 7.9 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -3 Query: 198 TEAEPSSKPNEPGRRTRRW--HLQSSVSAENLGSXEE*QFSHAVVLFRLRQSDRK 40 T+ + +++P P RR RW LQ + S E G E+ S+ LF+L D K Sbjct: 133 TQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSN---LFQLLLRDLK 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,073,350 Number of Sequences: 219361 Number of extensions: 452206 Number of successful extensions: 1137 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)