Clone Name | rbasd24h20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BAF1_YEAST (P14164) Transcription factor BAF1 (ARS-binding facto... | 28 | 8.9 | 2 | GRIN1_MOUSE (Q3UNH4) G protein-regulated inducer of neurite outg... | 28 | 8.9 |
---|
>BAF1_YEAST (P14164) Transcription factor BAF1 (ARS-binding factor 1) (Protein| ABF1) (Bidirectionally acting factor) (SFB-B) (DNA replication enhancer-binding protein OBF1) Length = 731 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 155 ITVTDNITLKSI-KASLHRERERETVGXGPNHGNDIGEDEHLDE 283 +T+ ++ SI KAS+ R + E+ GP HGND G H +E Sbjct: 183 VTIKNDTEDDSINKASIDRGLDDES---GPTHGNDSGNHRHNEE 223
>GRIN1_MOUSE (Q3UNH4) G protein-regulated inducer of neurite outgrowth 1 (GRIN1)| Length = 932 Score = 28.5 bits (62), Expect = 8.9 Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 10/90 (11%) Frame = +2 Query: 200 LHRERERE-TVGXGPN---HGNDIGEDEHLDEWVTQ------DNKNMPGSIGVIELHSSV 349 +H RER + G G ND+ ++ D T+ K PGS G EL SSV Sbjct: 210 MHSRRERPGSTGEGDLVSLRENDMKPPDNTDSASTKKTDPEFSGKLTPGSSGKTELVSSV 269 Query: 350 LVSPKPSLESHHPCYKMAGGSAKCQKLTLA 439 V+P S + C AG +A TL+ Sbjct: 270 TVAPVTSENVNPVCSGGAGPAAVGNSETLS 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,343,761 Number of Sequences: 219361 Number of extensions: 1439656 Number of successful extensions: 3449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3449 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)