Clone Name | rbasd24h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MPDZ_RAT (O55164) Multiple PDZ domain protein (Multi PDZ domain ... | 30 | 5.6 | 2 | SNU56_YEAST (Q03782) 56 kDa U1 small nuclear ribonucleoprotein c... | 30 | 5.6 | 3 | RPA1_MOUSE (O35134) DNA-directed RNA polymerase I largest subuni... | 30 | 7.3 |
---|
>MPDZ_RAT (O55164) Multiple PDZ domain protein (Multi PDZ domain protein 1)| (Multi-PDZ domain protein 1) Length = 2054 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 154 QSNQVSAKQLSSFSIIRSHLHLPEAAD 234 QS+QVS LSSFS+ RS +H E+++ Sbjct: 1803 QSSQVSESSLSSFSLPRSGIHTSESSE 1829
>SNU56_YEAST (Q03782) 56 kDa U1 small nuclear ribonucleoprotein component| Length = 492 Score = 30.4 bits (67), Expect = 5.6 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +2 Query: 89 YEVNRYSNNINGSNRKSKPCLGRATKFPQNNYPAFLSSEATSTSLRLRMKNMCAGSL 259 + VN+ SN +N SNR S P ++ + N P F++ + +K C G++ Sbjct: 338 HAVNKPSNVLNSSNRHSGPKTFEDGRYSEGNKPGFMTQD--------EIKQHCIGTI 386
>RPA1_MOUSE (O35134) DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6)| (RNA polymerase I 194 kDa subunit) (RPA194) Length = 1717 Score = 30.0 bits (66), Expect = 7.3 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +2 Query: 92 EVNRYSNNINGSNRKSKPC--LGRATKFPQNNYPAFLSSEATSTSLRLRMKNMCAGSLAI 265 EVN YSN IN K C LG +FP+NN + S A +++ + G + + Sbjct: 875 EVNHYSNEIN------KACMPLGLHRQFPENNLQMMVQSGAKGSTVNTMQISCLLGQIEL 928 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,530,778 Number of Sequences: 219361 Number of extensions: 1385991 Number of successful extensions: 3717 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3714 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7196276819 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)