Clone Name | rbasd24g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENGA_PORGI (Q7MT48) GTP-binding protein engA | 31 | 2.8 | 2 | LAMB3_MOUSE (Q61087) Laminin beta-3 chain precursor (Laminin 5 b... | 30 | 6.2 | 3 | BIOF_HELPJ (Q9ZLN3) 8-amino-7-oxononanoate synthase (EC 2.3.1.47... | 29 | 8.1 |
---|
>ENGA_PORGI (Q7MT48) GTP-binding protein engA| Length = 437 Score = 30.8 bits (68), Expect = 2.8 Identities = 23/63 (36%), Positives = 27/63 (42%) Frame = -2 Query: 435 GARLPNVTILLPTEKKQVDLDEREKTLKLAGRVGQAVGSLLRRLGIKYQGEESHGRMRIN 256 G L V LLP E Q DLDE + + GR SLL + GE+ H I Sbjct: 153 GDLLDRVMELLPAENGQSDLDETLPRIAIVGRPNAGKSSLLN----AFIGEDRHIVTDIA 208 Query: 255 GLT 247 G T Sbjct: 209 GTT 211
>LAMB3_MOUSE (Q61087) Laminin beta-3 chain precursor (Laminin 5 beta 3) (Kalinin| B1 chain) Length = 1168 Score = 29.6 bits (65), Expect = 6.2 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 9/119 (7%) Frame = -2 Query: 471 TTLKSLKHRLAAGARLPNVTILLPTEKK--------QVDLDE-REKTLKLAGRVGQAVGS 319 T L+ +K A ARLPNV +L K+ Q + ++ R + + G+V VG+ Sbjct: 923 TVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQAEAEQARSRAHAVEGQVDDVVGN 982 Query: 318 LLRRLGIKYQGEESHGRMRINGLTLRRWFNPKFTSAPSTGAPAELLPLPSRLAKGIADQ 142 LR+ + Q E+ M+ G +LR G ++L RL KG+ +Q Sbjct: 983 -LRQGTVALQ--EAQDTMQGTGRSLR-------LIQERVGEVQQVLVPAERLVKGMKEQ 1031
>BIOF_HELPJ (Q9ZLN3) 8-amino-7-oxononanoate synthase (EC 2.3.1.47) (AONS)| (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine--pimelyl CoA ligase) Length = 373 Score = 29.3 bits (64), Expect = 8.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 558 SCKALPQNIVKIVIDARKSNIYTAEVSLLTTLKSLKH 448 +C P +++ + + KS IYT +SLL T +L H Sbjct: 232 ACVLAPLQVIEFLTNRAKSVIYTTALSLLDTALTLAH 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,947,401 Number of Sequences: 219361 Number of extensions: 1389375 Number of successful extensions: 3917 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3916 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)