Clone Name | rbasd23p21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RNT1_ASPOR (P00651) Guanyl-specific ribonuclease T1 precursor (E... | 34 | 0.35 |
---|
>RNT1_ASPOR (P00651) Guanyl-specific ribonuclease T1 precursor (EC 3.1.27.3)| (RNase T1) Length = 130 Score = 34.3 bits (77), Expect = 0.35 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 171 TRTSIIHPDYLVCPSETVPQRSDNQFSGACYNSDDSSKIPGAFYQIHNSNKHV-HNK*PT 347 T T+++ P L PS V + D CY+S D S A YQ+H + V N P Sbjct: 8 TLTTLLLPTALALPS-LVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPH 66 Query: 348 K*ENYK 365 K NY+ Sbjct: 67 KYNNYE 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,380,434 Number of Sequences: 219361 Number of extensions: 1823232 Number of successful extensions: 3783 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3783 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)