ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd24e15 |
|---|---|
| Clone Library Name | barley_pub |
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 89.4 bits (220), Expect = 2e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD Sbjct: 111 SLLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 152
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 86.7 bits (213), Expect = 1e-17 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LLCDPNPNSPANSEAARM+SENKREYNR+VREVVEQSWTAD Sbjct: 111 SLLCDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWTAD 152
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 85.1 bits (209), Expect = 4e-17 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LLCDPNPNSPANSEAARMYSE+KREYNR+VR+VVEQSWTAD Sbjct: 111 SLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD 152
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 84.7 bits (208), Expect = 5e-17 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LLCDPNPNSPANSEAARM+SE+KREYNR+VREVVEQSWTAD Sbjct: 111 SLLCDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWTAD 152
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 70.9 bits (172), Expect = 8e-13 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LLCDPNP+SPAN+EAAR++SENKREYNRKV E+VEQS+ Sbjct: 111 SLLCDPNPDSPANAEAARLFSENKREYNRKVIEIVEQSY 149
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS+AA++Y ENKREY ++V +VEQSW Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW 149
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 61.2 bits (147), Expect = 6e-10 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL +PNPNSPANS AA++Y EN+REY ++V+++VEQSW Sbjct: 111 SLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQSW 149
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPNPNSPANS AA++Y EN+REY ++V+ VEQS+ Sbjct: 111 SLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSF 149
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LL DPNPNSPAN+EAA +Y EN +EY R+V+ VE SW D Sbjct: 111 SLLHDPNPNSPANAEAASLYRENMKEYVRRVKATVEASWLDD 152
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 54.3 bits (129), Expect = 8e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN SPAN EA+ +Y +N+REY ++VRE VE+SW Sbjct: 111 SLLNDPNTGSPANVEASNLYKDNRREYIKRVRETVERSW 149
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 54.3 bits (129), Expect = 8e-08 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN SPAN EA+ +Y +N++EY ++VRE VE+SW Sbjct: 111 SLLNDPNTGSPANVEASNLYKDNRKEYTKRVRETVEKSW 149
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 53.9 bits (128), Expect = 1e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN SPAN+EAA+++ ENK+EY R+VR+ VE SW Sbjct: 111 SLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSW 149
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 53.5 bits (127), Expect = 1e-07 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN +SPAN EA+ +Y +N++EY ++VRE VE+SW Sbjct: 111 SLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEKSW 149
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN +SPAN EA+ +Y +N++EY ++VRE VE+SW Sbjct: 111 SLLNDPNTSSPANVEASNLYRDNRKEYIKRVRETVEKSW 149
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPNP SPAN +AA+++ EN +EY R+V++ VE SW Sbjct: 111 SLLNDPNPASPANVDAAQLFKENLKEYERRVKKTVELSW 149
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 51.2 bits (121), Expect = 6e-07 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LL DPN +SPAN EAA +Y +++ +Y ++VRE VE SW D Sbjct: 111 SLLNDPNISSPANVEAANLYKDHRSQYIKRVRETVENSWNED 152
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 50.8 bits (120), Expect = 8e-07 Identities = 20/40 (50%), Positives = 32/40 (80%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPN +SPAN EA+ +Y +++++Y ++VR+ VE SWT Sbjct: 111 SLLNDPNTSSPANVEASMLYKDHRQQYEKRVRDTVEASWT 150
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +L DPNP SPAN EAA ++ ++K +Y ++V+E VE+SW D Sbjct: 111 SLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD 152
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +L DPNP SPAN EAA ++ ++K +Y ++V+E VE+SW D Sbjct: 111 SLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSWEDD 152
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +L DPNP SPAN EAA ++ ++K +Y ++V+E VE+SW D Sbjct: 111 SLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD 152
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +L DPNP SPAN EAA ++ ++K +Y ++V+E VE+SW Sbjct: 111 SLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSW 149
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 +LL DPN +SPAN EAA +Y +++ Y ++VRE VE SW D Sbjct: 111 SLLNDPNISSPANVEAANLYKDHRSLYVKRVRETVENSWNDD 152
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSW 208 +LL DPN S AN + +Y +N++EY+++VRE VE+SW Sbjct: 111 SLLNDPNTGSRANVAPSNLYKDNRKEYHKRVRETVEKSW 149
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDREKYNRIARE 140
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDREKYNRIARE 140
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDREKYNRIARE 140
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDREKYNRIARE 140
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P + A++Y +K +YNR RE Sbjct: 108 SLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE 140
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P + A++Y +K +YNR RE Sbjct: 108 SLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE 140
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YN RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDREKYNELARE 140
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ YN+ RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDRERYNQLARE 140
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E A++Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIAQIYKTDRDKYNRTARE 140
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE 140
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE 140
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LLCDPNP+ P E AR+Y ++ +YNR RE Sbjct: 108 SLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE 140
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKV 232 LL PNPNSPA A R +S NK EY++KV Sbjct: 119 LLDSPNPNSPAQEPAWRSFSRNKAEYDKKV 148
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L PN SPAN +AA+ + EN +E+ ++VR +V +S Sbjct: 126 SMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRS 163
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L DPN SPAN +AA+M EN E+ +KV + V +S Sbjct: 124 SMLTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRRS 161
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 39.3 bits (90), Expect = 0.002 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 +LL DPN NSPAN +AA Y +N +Y ++V+ VE+S Sbjct: 130 SLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERS 167
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L PN SPAN EAA+ + E + E+ +KVR V +S Sbjct: 127 SMLSSPNDESPANIEAAKDWREKQDEFKKKVRRAVRKS 164
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 LL PNP P N +AA MY EY +K++E +++ T + Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEE 152
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 LL PNP P N +AA MY EY +K++E +++ T + Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEE 152
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L PN SPAN EAA+ + +N+ E+ +KV V +S Sbjct: 126 SMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRRS 163
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 LL PNP P NSE A +Y +K Y++K+R+ Sbjct: 116 LLDQPNPEDPFNSELASLYRNDKLSYDKKIRD 147
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 35.8 bits (81), Expect = 0.028 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L PN SPAN EAA+ + E + E+ +KV V +S Sbjct: 125 SMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRKS 162
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 35.8 bits (81), Expect = 0.028 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 LL PNP+ P N EAA + +K Y KV+E E+ Sbjct: 110 LLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCER 145
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKR-EYNRKVREVVEQS 211 ++L DPN +SPAN +AA+ + E++ E+ RKV V +S Sbjct: 125 SMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 163
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKR-EYNRKVREVVEQS 211 ++L DPN +SPAN +AA+ + E++ E+ RKV V +S Sbjct: 125 SMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 163
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKR-EYNRKVREVVEQS 211 ++L DPN +SPAN +AA+ + E++ E+ RKV V +S Sbjct: 125 SMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 163
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 35.0 bits (79), Expect = 0.047 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 5/43 (11%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAAR-----MYSENKREYNRKVREVVEQS 211 +LL +PNP+SPAN +AA+ +Y E+ Y +V++ V++S Sbjct: 116 SLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEVKKTVKKS 158
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 34.7 bits (78), Expect = 0.062 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L PN SPAN EAA+ + + + E+ +KV V +S Sbjct: 125 SMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRKS 162
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 34.7 bits (78), Expect = 0.062 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL DPN SPA +EA M+ ++K EY ++VR Sbjct: 119 LLDDPNIASPAQTEAYTMFKKDKVEYEKRVR 149
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 34.7 bits (78), Expect = 0.062 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 5/43 (11%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAAR-----MYSENKREYNRKVREVVEQS 211 +LL +PNP+SPAN +AA+ +Y E+ Y +V++ V++S Sbjct: 116 SLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKKS 158
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 34.3 bits (77), Expect = 0.080 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPNP+ P E A MY +K +Y E +SWT Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKTDKNKY-----ESTARSWT 142
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 34.3 bits (77), Expect = 0.080 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PNPN P N +AA++ E ++E+ VR Sbjct: 139 LFLEPNPNDPLNKDAAKLLCEGEKEFAEAVR 169
>UBC7_SCHPO (O00102) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 166 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQS 211 ++L +PN S AN +A +M+ E++ EY R VR + ++ Sbjct: 126 SMLAEPNDESGANIDACKMWREDREEYCRVVRRLARKT 163
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 33.9 bits (76), Expect = 0.10 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 199 LL +PN + P N+EAA + +K+ Y K++E +++ T + Sbjct: 110 LLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYATKE 150
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVE 217 LL PNP S N EA R+ EN EY + R + E Sbjct: 119 LLIHPNPESALNEEAGRLLLENYEEYAARARLLTE 153
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVE 217 LL PNP S N EA R+ EN EY + R + E Sbjct: 119 LLIHPNPESALNEEAGRLLLENYEEYAARARLLTE 153
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPNP+ P E A MY ++ +Y E +SWT Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWT 142
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++VR Sbjct: 119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++VR Sbjct: 119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++VR Sbjct: 119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++VR Sbjct: 119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++VR Sbjct: 119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 33.1 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 LL PNP+ P N EAA + ++ Y KV+E E+ Sbjct: 110 LLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEK 145
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPNP+ P E A MY +K +Y E ++WT Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKTDKNKY-----ESTARTWT 142
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 LL PNP+ P N EAA + ++ Y ++V+E E+ Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEK 145
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 LL PNP+ P N EAA + ++ Y ++V+E E+ Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEK 145
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 LL PN PA +EA ++Y +N+ EY ++V++ Sbjct: 119 LLNHPNIEDPAQAEAYQIYCQNRAEYEKRVKK 150
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVREVV 220 L +PNP P N EAA + N+R++ V++ + Sbjct: 132 LFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAM 165
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 32.7 bits (73), Expect = 0.23 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPNP+ P E A MY ++ +Y E +SWT Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKTDRSKY-----ESTARSWT 142
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 32.3 bits (72), Expect = 0.31 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 205 +LL DPNP+ P E A MY ++ +Y E ++WT Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKTDRAKY-----EATARNWT 142
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 +LL +PN SP N+ AA ++ + EY +KV E+ Sbjct: 116 SLLGEPNNRSPLNAVAAELWDADMEEYRKKVLACYEE 152
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 31.2 bits (69), Expect = 0.68 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 LL +PN PA +EA +Y +N+ EY ++ R Sbjct: 119 LLNEPNIQEPAQAEAYTIYCQNRVEYEKRFR 149
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PNP P N EAA + N+R + + V+ Sbjct: 135 LFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PNP P N EAA + N+R + + V+ Sbjct: 135 LFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PNP P N EAA + N+R + + V+ Sbjct: 135 LFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PNP P N EAA + N+R + + V+ Sbjct: 135 LFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQ 165
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 31.2 bits (69), Expect = 0.68 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LL DPNP+ P E A +Y ++ Y RE Sbjct: 108 SLLTDPNPDDPLVPEIAHVYKTDRSRYELSARE 140
>UBC12_CAEEL (Q9XVK5) NEDD8-conjugating enzyme ubc-12 (EC 6.3.2.-) (NEDD8| protein ligase) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 12) Length = 180 Score = 30.8 bits (68), Expect = 0.89 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -1 Query: 300 NSPANSEAARMYSENKREYNRKVREVVEQ 214 N N +AA+M+S+N+ +N +VRE + + Sbjct: 150 NDALNIQAAQMWSQNRESFNHRVREYISR 178
>CPXM2_HUMAN (Q8N436) Carboxypeptidase-like protein X2 precursor| Length = 756 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 129 WYRPAKPEMETFRASLIAGPGDASPLSSSAPRP 227 +Y +PE+ETF L AGPG+ PRP Sbjct: 46 YYARPEPELETFSPPLPAGPGEEWERRPQEPRP 78
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNR 238 +LL +PN SP N++AA ++S++ EY R Sbjct: 136 SLLGEPNNASPLNAQAAELWSKDPIEYKR 164
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 ++L DPNP+ P E A +Y ++ Y RE Sbjct: 108 SMLTDPNPDEPLVPEIAHVYKTDRARYEATARE 140
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVR 229 +L +PN N P N EAA + +++K E+ VR Sbjct: 139 SLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVR 170
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 321 LLCDPNPNSPANSEAARMYSENKREYNRKVR 229 L +PN + P N +AA + N+ E+ R V+ Sbjct: 130 LFLEPNASDPLNKDAAHQMTANREEFKRNVK 160
>UB2EC_SPISO (Q95044) Ubiquitin-conjugating enzyme E2-C (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 177 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 +LL +PN SP N++AA M+S N+ EY + + E Sbjct: 137 SLLGEPNNASPLNAQAADMWS-NQTEYKKVLHE 168
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 ALL PNPN P ++ A + +N++ K RE Sbjct: 110 ALLASPNPNDPLANDVAEDWIKNEQGAKAKARE 142
>K1683_HUMAN (Q9H0B3) Protein KIAA1683| Length = 1180 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -3 Query: 193 SPGPAISDARNVSISGFAGLYHRTKTLKNPWPL---CPCA*SPVVFSVRVTCLVN 38 +P P + + G A L H+T T++ P P+ C + ++R TCLV+ Sbjct: 219 TPEPCVQGPHAARVRGLAFLPHQTVTIRFPCPVSLDAKCQPCLLTRTIRSTCLVH 273
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 ++L DPNP+ P E A +Y + +Y RE Sbjct: 108 SMLTDPNPDDPLVPEIAHVYRTARAQYEATARE 140
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 ALL PNP+ P ++ A ++ N+ E R RE Sbjct: 110 ALLSAPNPDDPLANDVAELWKVNEAEAIRNARE 142
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNR 238 ALL P PN P ++E A+ Y ++ +N+ Sbjct: 111 ALLQSPEPNDPQDAEVAQHYLRDRESFNK 139
>NIFJ_ECOLI (P52647) Probable pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)| Length = 1174 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 153 METFRASLIAGPGDASPLSSSAPRPHAPCGCTR 251 ++T A+++AG GDA P+S+ P P G TR Sbjct: 639 VKTVTAAMLAGLGDALPVSALPPDGTWPMGTTR 671
>ANC2_CAEEL (P34514) Anaphase-promoting complex subunit 2 (APC2) (Cyclosome| subunit 2) Length = 728 Score = 29.3 bits (64), Expect = 2.6 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +3 Query: 60 TEKTTGDQAQGHNGHGFFNVLVRWYRPAKPEMETFRASLIAGPGDASPLSSS 215 T+ T GD A GH G FN+LV Y + ++ +R L A LSSS Sbjct: 382 TDATVGDGAPGHQGVDVFNMLVSVYGSKELFVKEYRNLL------AERLSSS 427
>PLIN_HUMAN (O60240) Perilipin (PERI) (Lipid droplet-associated protein)| Length = 522 Score = 29.3 bits (64), Expect = 2.6 Identities = 22/76 (28%), Positives = 30/76 (39%) Frame = -3 Query: 316 VRPESEFSSQLRSSQNVQREQARVQPQGA*GRGAELDSGLASPGPAISDARNVSISGFAG 137 + PESEF V+R +A + GA G E LA P ++ A++ G Sbjct: 410 MEPESEFRDIDNPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPG 469 Query: 136 LYHRTKTLKNPWPLCP 89 L T P P P Sbjct: 470 LEDEVATPAAPRPGFP 485
>GALT7_MOUSE (Q80VA0) N-acetylgalactosaminyltransferase 7 (EC 2.4.1.-)| (Protein-UDP acetylgalactosaminyltransferase 7) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7) (Polypeptide GalNAc transferase 7) (GalNAc-T7) (pp-GaNTase 7) Length = 657 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +3 Query: 45 KQVTRTEKTTGDQAQGHNGHGFFNVLVRWYRPAKPEMETFRASLIAGPGDASPLSSSAPR 224 + + R K +Q + G +V+ R Y KP+ T+R ++ PG P Sbjct: 83 ESIRRKNKAKNEQERHAGGDSQRDVMQRQYLTFKPQTFTYRDPVLR-PGVLGNFEPKEPE 141 Query: 225 PHAPCG 242 PH G Sbjct: 142 PHGVVG 147
>GALT7_RAT (Q9R0C5) N-acetylgalactosaminyltransferase 7 (EC 2.4.1.-)| (Protein-UDP acetylgalactosaminyltransferase 7) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7) (Polypeptide GalNAc transferase 7) (GalNAc-T7) (pp-GaNTase 7) Length = 657 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/66 (24%), Positives = 27/66 (40%) Frame = +3 Query: 45 KQVTRTEKTTGDQAQGHNGHGFFNVLVRWYRPAKPEMETFRASLIAGPGDASPLSSSAPR 224 + + R K +Q + G +++ R Y KP+ T+R ++ PG P Sbjct: 83 ESIRRKNKAKNEQERHAGGDSQKDIMQRQYLTFKPQTFTYRDPVLR-PGVLGNFEPKEPE 141 Query: 225 PHAPCG 242 PH G Sbjct: 142 PHGVVG 147
>CT059_MOUSE (Q8VCL5) Putative transporter C20orf59 homolog| Length = 439 Score = 28.5 bits (62), Expect = 4.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 243 CTRACSRCTFWLLRSWL 293 C++ CS C+F++L SWL Sbjct: 249 CSQLCSACSFFILLSWL 265
>UTP14_YEAST (Q04500) U3 small nucleolar RNA-associated protein 14 (U3| snoRNA-associated protein 14) Length = 899 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 300 NSPANSEAARMYSENKREYNRKVREVVEQSWTAD*RHQVL 181 N S A EN+ +Y R +R + Q WT+ HQ L Sbjct: 839 NLKYQSSAVPFPFENREQYERSLRMPIGQEWTSRASHQEL 878
>FLVC1_FELCA (Q9N1F2) Feline leukemia virus subgroup C receptor-related protein| 1 Length = 560 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 120 LVRWYRPAKPEMETFRASLIAGPGDASPLSSSAPRPHAPCGCTR 251 L R P PE ET L GPG+ +P + +P P R Sbjct: 64 LCRPQTPLAPEEETQTRLLPTGPGEETPGTEGSPAPQTALSARR 107
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 AL+ DP P P ++ A YS++++++ + E ++ Sbjct: 110 ALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKK 146
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQ 214 AL+ DP P P ++ A YS++++++ + E ++ Sbjct: 110 ALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKK 146
>YAU8_SCHPO (Q10163) Hypothetical protein C26A3.08 in chromosome I| Length = 147 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 138 PAKPEMETFRASLIAGPGDASPLSSSAPRPHAPCG 242 P P M R SL++GPG A P P AP G Sbjct: 85 PMDPSM---RGSLLSGPGVARPAGRGIPLGQAPVG 116
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENKREYNRKVRE 226 AL+ PNP+ P +++ A+++ EN+ + RE Sbjct: 109 ALMGAPNPDDPLDNDVAKIWKENEPQAIANARE 141
>NYLA_PSES8 (P13398) 6-aminohexanoate-cyclic-dimer hydrolase (EC 3.5.2.12)| (Nylon oligomers degrading enzyme EI) Length = 492 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 220 GAELDSGLASPGPAISDARNVSISGFAGLYHRT 122 G + G SPGP ++D+ NV+ + GL+ R+ Sbjct: 185 GLKPTRGRISPGPLVTDSDNVAGAAHEGLFARS 217
>NYLA_FLASK (P13397) 6-aminohexanoate-cyclic-dimer hydrolase (EC 3.5.2.12)| (Nylon oligomers degrading enzyme EI) Length = 492 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 220 GAELDSGLASPGPAISDARNVSISGFAGLYHRT 122 G + G SPGP ++D+ NV+ + GL+ R+ Sbjct: 185 GLKPTRGRISPGPLVTDSDNVAGAAHEGLFARS 217
>UB2R1_MOUSE (Q8CFI2) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 235 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENK------REYNRKVREVV 220 +LL +PN SPAN +A+ MY + K REY +R+ V Sbjct: 129 SLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQV 169
>UB2R1_HUMAN (P49427) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 236 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = -1 Query: 324 ALLCDPNPNSPANSEAARMYSENK------REYNRKVREVV 220 +LL +PN SPAN +A+ MY + K REY +R+ V Sbjct: 129 SLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQV 169
>SOX13_HUMAN (Q9UN79) SOX-13 protein (Type 1 diabetes autoantigen ICA12) (Islet| cell antigen 12) Length = 889 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 309 PNPNSPANSEAARMYSENKREYNRKVREVV 220 P P P SEAA S+ K ++NR ++EVV Sbjct: 66 PEPKRPGVSEAASG-SQEKLDFNRNLKEVV 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,668,585 Number of Sequences: 219361 Number of extensions: 954921 Number of successful extensions: 3225 Number of sequences better than 10.0: 114 Number of HSP's better than 10.0 without gapping: 3137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3222 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
