Clone Name | rbasd24e13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1693_SYNPX (Q7U5L0) UPF0161 protein SYNW1693 | 28 | 7.7 |
---|
>Y1693_SYNPX (Q7U5L0) UPF0161 protein SYNW1693| Length = 66 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 209 VDRHAVXXXAGLRXSRLLTCSPGRNCRCDP 298 + RH L RLL C P C CDP Sbjct: 34 IQRHGPWKGGWLTVKRLLRCHPFTPCGCDP 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,692,193 Number of Sequences: 219361 Number of extensions: 483472 Number of successful extensions: 904 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)