Clone Name | rbasd24d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-as... | 32 | 0.65 |
---|
>KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-associated| protein 15.1) Length = 136 Score = 32.3 bits (72), Expect = 0.65 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +1 Query: 109 PCQSHYTSALKSGNIGQTKGKYIYMSTSVQVTDASKYCHHRQNRCSPTMTSS 264 PCQ+ YT +L SGNIG G + ST Q N CSPT SS Sbjct: 85 PCQTIYTGSLGSGNIG--LGSFGCGSTGFQSLGCG------SNFCSPTYVSS 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,663,155 Number of Sequences: 219361 Number of extensions: 1433415 Number of successful extensions: 3710 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3709 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)