Clone Name | rbasd23n21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DRL25_ARATH (O50052) Putative disease resistance protein At4g19050 | 29 | 8.1 | 2 | HY6H_HYONI (P24397) Hyoscyamine 6-dioxygenase (EC 1.14.11.11) (H... | 29 | 8.1 | 3 | PUIB_WHEAT (Q10464) Puroindoline-B precursor | 29 | 8.1 |
---|
>DRL25_ARATH (O50052) Putative disease resistance protein At4g19050| Length = 1181 Score = 29.3 bits (64), Expect = 8.1 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +2 Query: 326 FQSSKGISLPPVAHLTGSFNRTSTVGVVGCF---NCTRLLQLHKSVSTTSLARIDMC 487 F +K I LP + HL S N ST+ ++ NCTRL +L + T+L +D C Sbjct: 607 FSETKIIRLP-IFHLKDSTNDFSTMPILTRLLLRNCTRLKRLPQLRPLTNLQILDAC 662
>HY6H_HYONI (P24397) Hyoscyamine 6-dioxygenase (EC 1.14.11.11) (Hyoscyamine| 6-beta-hydroxylase) Length = 344 Score = 29.3 bits (64), Expect = 8.1 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = -3 Query: 286 HLNEGLGLRFLYKFRGFKSRVSTFELEPYMPCLPDPSASHGNWRSFDVQRLTV 128 ++ EGLGL+ Y F S++ Y PC PDPS++ G+ +D +T+ Sbjct: 175 YICEGLGLKLGY-FDNELSQIQMMLTNYYPPC-PDPSSTLGSGGHYDGNLITL 225
>PUIB_WHEAT (Q10464) Puroindoline-B precursor| Length = 148 Score = 29.3 bits (64), Expect = 8.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 476 SWPTKWWKHSCAVE 435 +WPTKWWK C E Sbjct: 67 TWPTKWWKGGCEHE 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,317,323 Number of Sequences: 219361 Number of extensions: 1529839 Number of successful extensions: 3070 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3070 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)