Clone Name | rbasd23n19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1841_MYCTU (Q50593) Hypothetical protein Rv1841c/MT1889 | 30 | 5.8 | 2 | TLC1_ARATH (Q39002) Chloroplast ADP,ATP carrier protein 1, chlor... | 30 | 5.8 | 3 | VGLM_HANTV (P08668) Envelope polyprotein precursor (M polyprotei... | 29 | 9.9 |
---|
>Y1841_MYCTU (Q50593) Hypothetical protein Rv1841c/MT1889| Length = 345 Score = 29.6 bits (65), Expect = 5.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 108 FGFSSLPPASMYSVCMVHCVQADLLLGSQLPK 13 FG S +PPA ++++ + V +LLG +PK Sbjct: 90 FGLSGVPPALLHTLSLAIVVALHVLLGEMVPK 121
>TLC1_ARATH (Q39002) Chloroplast ADP,ATP carrier protein 1, chloroplast| precursor (ADP/ATP translocase 1) (Adenine nucleotide translocase 1) Length = 624 Score = 29.6 bits (65), Expect = 5.8 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 274 LATSLRTVLQLRFMLPLAVARPWATCL 194 LA L T L RFM P+A+ R W+ CL Sbjct: 214 LADKLLTTLGPRFMGPIAILRIWSFCL 240
>VGLM_HANTV (P08668) Envelope polyprotein precursor (M polyprotein) [Contains:| Glycoprotein G1; Glycoprotein G2] Length = 1135 Score = 28.9 bits (63), Expect = 9.9 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -1 Query: 225 WRWLVPGLLVWRKVMLMMLLDER*IGLYLCYPCGENWKVFGFSSLPPASM 76 W+WLV LVW + L + D + I GEN V G+ LPP + Sbjct: 4 WKWLVMASLVWPVLTLRNVYDMK-IECPHTVSFGEN-SVIGYVELPPVPL 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,018,064 Number of Sequences: 219361 Number of extensions: 1178901 Number of successful extensions: 3128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3123 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)