| Clone Name | rbasd24c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FA55D_HUMAN (Q6UWF7) Protein FAM55D precursor | 37 | 0.011 | 2 | BB61_RABIT (Q05004) Brush border protein AdRab-A precursor | 35 | 0.056 | 3 | FA55D_RAT (Q5XI89) Protein FAM55D precursor | 35 | 0.073 | 4 | FA55D_MOUSE (Q52KP5) Protein FAM55D precursor | 34 | 0.096 | 5 | YJGH_ECOLI (P39332) Hypothetical UPF0076 protein yjgH | 28 | 6.9 |
|---|
>FA55D_HUMAN (Q6UWF7) Protein FAM55D precursor| Length = 544 Score = 37.4 bits (85), Expect = 0.011 Identities = 16/48 (33%), Positives = 31/48 (64%) Frame = -3 Query: 147 VMRAMFSDLPVTILDVWQMTSCHREPENLXXPXVXVKNEIDLMLSFIC 4 +++ +F DL V+I+D W +T + N+ P V N+I+++L++IC Sbjct: 498 IIKDIFQDLSVSIIDAWDITIAY-GTNNVHPPQHVVGNQINILLNYIC 544
>BB61_RABIT (Q05004) Brush border protein AdRab-A precursor| Length = 540 Score = 35.0 bits (79), Expect = 0.056 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = -3 Query: 144 MRAMFSDLPVTILDVWQMTSCHREPENLXXPXVXVKNEIDLMLSFIC 4 ++ +F DL V ++D W MT + N+ P + N+I++ L++IC Sbjct: 495 LKDIFKDLNVGVVDAWDMTIAY-GTNNVHPPDQVIGNQINMFLNYIC 540
>FA55D_RAT (Q5XI89) Protein FAM55D precursor| Length = 542 Score = 34.7 bits (78), Expect = 0.073 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -3 Query: 144 MRAMFSDLPVTILDVWQMTSCHREPENLXXPXVXVKNEIDLMLSFIC 4 ++ +F DL V ++D W MT + ++ P V++EI++ L++IC Sbjct: 497 LKNIFQDLRVGVIDAWDMTVAY-GTNDVHPPEEVVRSEINIFLNYIC 542
>FA55D_MOUSE (Q52KP5) Protein FAM55D precursor| Length = 543 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -3 Query: 144 MRAMFSDLPVTILDVWQMTSCHREPENLXXPXVXVKNEIDLMLSFIC 4 ++ +F DL V ++D W MT + N+ P V+++I++ L++IC Sbjct: 498 LKDIFQDLNVGVIDAWDMTVAY-GINNVHPPEDVVRSQINIFLNYIC 543
>YJGH_ECOLI (P39332) Hypothetical UPF0076 protein yjgH| Length = 131 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 114 TILDVWQMTSCHREPENLXXPXVXVKNEI 28 T D+ +TS H +PEN + VKNEI Sbjct: 70 TFDDIIDVTSFHTDPENQFEDIMTVKNEI 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,227,768 Number of Sequences: 219361 Number of extensions: 178824 Number of successful extensions: 389 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)