| Clone Name | rbasd23n04 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_RHIME (Q59750) Beta-galactosidase (EC 3.2.1.23) (Lactase)| Length = 755 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 280 HPGAXYVVXXALQNSKGSLHSXXTNAIRPHVELLRTSPY 164 H YV + +KGS H+ NA R H L+RTS Y Sbjct: 281 HQSFPYVGLRMGRTAKGSAHADIMNAHRLHCNLVRTSHY 319
>YDHE_SCHPO (Q92359) Hypothetical protein C6G9.14 in chromosome I| Length = 681 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = -3 Query: 319 QLLXAPQFERLLLHPGAXYVVXXALQNSKGSLHSXXTNAIRPHVELLRTSPYCKRIYSR 143 +L+ +LL A YV+ AL N+ + I+P + ++ +P +RI S+ Sbjct: 596 ELMDEKHLPKLLRDSFANYVIQTALDNASVKQRAELVERIKPLIPSIKNTPCGRRILSK 654
>TRMU_BORBU (O51625) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 355 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Frame = +1 Query: 7 FDLYKDLHGEITFIPFESEKIAQDKLSLLLHMVRWSHQTIT----FSAKL---ESRSSCS 165 F + KDL I +I + Q K L+H + W + T T F K+ E + SC Sbjct: 251 FVIEKDLEKNIIYISHNENYLKQAKRKFLVHEIHWINDTPTNFENFKIKIRHGEKKYSCK 310 Query: 166 M 168 + Sbjct: 311 L 311
>ZN250_HUMAN (P15622) Zinc finger protein 250 (Zinc finger protein 647)| Length = 560 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 113 DHLTMCNNKDSLSCAIFSDSKG 48 DH T C +DSLSC ++KG Sbjct: 105 DHTTACTQQDSLSCPWECETKG 126
>MPP5_MOUSE (Q9JLB2) MAGUK p55 subfamily member 5 (Protein associated with| Lin-7 1) Length = 675 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 FDLYKDLHGEITFIPFESEKI 69 FDL D+HG +TF+ S++I Sbjct: 318 FDLLSDMHGTLTFVLIPSQQI 338
>MPP5_HUMAN (Q8N3R9) MAGUK p55 subfamily member 5| Length = 675 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 7 FDLYKDLHGEITFIPFESEKI 69 FDL D+HG +TF+ S++I Sbjct: 318 FDLLSDMHGTLTFVLIPSQQI 338 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,777,526 Number of Sequences: 219361 Number of extensions: 692473 Number of successful extensions: 1397 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1397 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)