Clone Name | rbasd24b19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DPO3A_PSEAE (Q9HXZ1) DNA polymerase III alpha subunit (EC 2.7.7.7) | 28 | 6.5 |
---|
>DPO3A_PSEAE (Q9HXZ1) DNA polymerase III alpha subunit (EC 2.7.7.7)| Length = 1173 Score = 28.1 bits (61), Expect = 6.5 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 72 IKTXXEDGTTETIYLVALYN*GLVRSAMXLSFMXRKNLKAEL 197 IK D + I LVAL+ G ++S M F+ RK+ +AEL Sbjct: 621 IKKLKPDCLEDLIALVALFRPGPLQSGMVDDFINRKHGRAEL 662 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,230,519 Number of Sequences: 219361 Number of extensions: 303721 Number of successful extensions: 311 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)