| Clone Name | rbasd24b08 |
|---|---|
| Clone Library Name | barley_pub |
>RU17_XENLA (P09406) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 40.0 bits (92), Expect = 0.005 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E++ D+E ++D RD D +R+RDR + HR RD+ D+++ R R RDR Sbjct: 355 ERDRDREKGEKD---RDKDRDRDRDRRRSHRDRDREKD-RDRDRDRRR-DRDR 402 Score = 38.9 bits (89), Expect = 0.012 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+ QE ++ R+ D ER+RDR K + RDK D+++ R RS RDR Sbjct: 340 ELKQEPEEKS---RERDRERDRDREKGEKDRDKD---RDRDRDRRRSHRDR 384 Score = 34.3 bits (77), Expect = 0.29 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 +V+ RD R + +RER+R +R RSR++ ++ +SR R R ++ Sbjct: 208 DVNIRHSGRDDTSRYDERDRERERDRRERSREREKEPRERRRSRSRERRRKS 259 Score = 33.9 bits (76), Expect = 0.38 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 D R + D ERERDR +R R R+K + +SR R + R+ Sbjct: 217 DDTSRYDERDRERERDRRERSREREKEPRERRRSRSRERRRKSRS 261 Score = 33.5 bits (75), Expect = 0.50 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Frame = -1 Query: 612 EKEVDQEAX-DRDIRG--RDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRA 451 EK+ D++ DRD R RD D E++RDR + R R RD+ DK+ R R DR+ Sbjct: 364 EKDRDKDRDRDRDRRRSHRDRDREKDRDRDRDRRRDRDRDR-ERDKDHKRERDRGDRS 420 Score = 32.3 bits (72), Expect = 1.1 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 8/61 (13%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDK--------SSGYSDKEKSRHRSSRD 457 E++ + + +R+ R+ R R+R ++ RSR+K S DKEK + RD Sbjct: 230 ERDRRERSREREKEPRERRRSRSRERRRKSRSREKEERKRTREKSKDKDKEKDKDNKDRD 289 Query: 456 R 454 R Sbjct: 290 R 290 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDK 508 DRD R RD DH+RERDR R R++ Sbjct: 401 DRD-RERDKDHKRERDRGDRSEKREE 425 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/61 (32%), Positives = 32/61 (52%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 E D+E +RD R R + E+E +R RSR++ +EK + +R++ S DK Sbjct: 224 ERDRER-ERDRRERSREREKEPRERRRSRSRERRRKSRSREKEERKRTREK-----SKDK 277 Query: 426 D 424 D Sbjct: 278 D 278
>RU17_DROME (P17133) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) Length = 448 Score = 38.9 bits (89), Expect = 0.012 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERD-RAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSS 436 E+ + + DR R R+ D +RER+ + KR +SR++ S +E+ R R R+R G S Sbjct: 297 ERYDEFDRRDRRDRERERDRDREREKKKKRSKSRERESSRERRERKRERRDRER-GTGSG 355 Query: 435 GD 430 GD Sbjct: 356 GD 357
>K0553_HUMAN (Q9UKJ3) Protein KIAA0553| Length = 1089 Score = 38.5 bits (88), Expect = 0.016 Identities = 22/59 (37%), Positives = 27/59 (45%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 DQ R D + DR++RH R S SD S+HRS R + YSS D D Sbjct: 466 DQSCYSRQRSYSDDSYSDYSDRSRRHSKRSHDSDDSDYASSKHRSKRHK---YSSSDDD 521
>RU17_MOUSE (Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70| kDa) (snRNP70) Length = 448 Score = 38.5 bits (88), Expect = 0.016 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 D+ + RD D +RER+R +R R RDK ++E+ R R SRDR S DKD Sbjct: 220 DERPGPSPLPHRDRDRDRERERRERSRERDK-----ERERRRSR-SRDRRRRSRSRDKD 272 Score = 35.8 bits (81), Expect = 0.10 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 6/59 (10%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERER------DRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 +++ D+E R+ R R+ D ERER DR +R RSRDK +E+S+ + RDR Sbjct: 232 DRDRDRERERRE-RSRERDKERERRRSRSRDRRRRSRSRDKDERRRSRERSKDK-DRDR 288 Score = 34.7 bits (78), Expect = 0.23 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHE-RERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 +E D+E R R RD R RD+ +R RSR++S K R SR+RA Sbjct: 246 RERDKERERRRSRSRDRRRRSRSRDKDERRRSRERSKDKDRDRKRRSSRSRERA 299 Score = 31.2 bits (69), Expect = 2.5 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Frame = -1 Query: 573 RGRDSDHERER-----DRAK-----RHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 R RD D ERER +R K R RSRD+ ++K R SR+R S DKD Sbjct: 231 RDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKDERRRSRER-----SKDKD 285
>DHX8_ARATH (Q38953) Probable pre-mRNA-splicing factor ATP-dependent RNA| helicase (EC 3.6.1.-) Length = 1168 Score = 38.1 bits (87), Expect = 0.020 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 13/64 (20%) Frame = -1 Query: 612 EKEVDQEAX----------DRDIR--GRDSDHERERDR-AKRHRSRDKSSGYSDKEKSRH 472 EKE+++EA DRD R GRD D +R RDR +R R RD+ D+E Sbjct: 111 EKEIEREAEERRREEDRNRDRDRRESGRDRDRDRNRDRDDRRDRHRDRERNRGDEEGEDR 170 Query: 471 RSSR 460 RS R Sbjct: 171 RSDR 174
>RBM25_HUMAN (P49756) Probable RNA-binding protein 25 (RNA-binding motif protein| 25) (RNA-binding region-containing protein 7) (Protein S164) Length = 784 Score = 38.1 bits (87), Expect = 0.020 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDR 454 +KE +++ +++ R R+ + ERER+R +R R R++ +KEK R R RDR Sbjct: 238 KKEKERQEIEKERRERERERERERERRERERERERER-EREKEKERERERERDR 290 Score = 37.4 bits (85), Expect = 0.035 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDR-AKRHRSRDKSSGYSDKEKSRHRS---SRDR 454 EKE ++E R RD ER+RDR +R R RD+ SD+ K R RS SRDR Sbjct: 277 EKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERS-SDRNKDRSRSREKSRDR 332 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGY 445 EK D+E R R+ + ERER+R + + +K+K R R + Y Sbjct: 327 EKSRDREREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAY 382 Score = 31.2 bits (69), Expect = 2.5 Identities = 23/42 (54%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -1 Query: 585 DRDIRGRDSDHERER--DRAK-RHRSRDKSSGYSDKEKSRHR 469 DRD R RD D +RER DR K R RSR+KS D+E+ R R Sbjct: 301 DRD-RERDRDRDRERSSDRNKDRSRSREKS---RDRERERER 338 Score = 31.2 bits (69), Expect = 2.5 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++E +R+ R R+ + ERER+R K R R RD+ D+ K R R RDR Sbjct: 252 ERERERER-ERERREREREREREREREKEKERERERERDRD---RDRTKERDR-DRDR 304 Score = 30.8 bits (68), Expect = 3.3 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDR---AKRHRSRDKSSGYSDKEKSRHRSS 463 E+E ++E + R+ + ER+RDR +R R RD+ D+++ R RSS Sbjct: 267 EREREREREREKEKERERERERDRDRDRTKERDRDRDRE---RDRDRDRERSS 316 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDR-AKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 E+E ++E R R+ + ERER++ KR R D+ Y ++ R ++ A Sbjct: 343 EREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAA 397
>ACINU_MOUSE (Q9JIX8) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1338 Score = 37.7 bits (86), Expect = 0.027 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRD 457 +++++E R R+ D ERERDR R R R++ D+++ R R RD Sbjct: 1272 RQLEREKRREHSRERERDRERERDRGDRERERER-----DRDRGRERDRRD 1317 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 R RD + ER+R +R R RD+ G + R SR R+ Sbjct: 1286 RERDRERERDRGDRERERERDRDRGRERDRRDTKRHSRSRS 1326 Score = 31.2 bits (69), Expect = 2.5 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRAG 448 E+E D+E +RD RG D + ERERDR + R R R + +S + +SR RDR G Sbjct: 1285 ERERDRER-ERD-RG-DRERERERDRDRGRERDRRDTKRHS-RSRSRSTPVRDRGG 1336
>ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1341 Score = 37.7 bits (86), Expect = 0.027 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRS-SRDR 454 EKE ++E + R + +H RERDR + R R RD+ D+E+ R R RDR Sbjct: 1264 EKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDR 1318 Score = 36.6 bits (83), Expect = 0.059 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRD 457 +++++E R RD + ERER+R + R RD+ D+E+ R R RD Sbjct: 1273 RQLEREKRREHSRERDRERERERERDRGDRDRDRE---RDRERGRERDRRD 1320 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 E+E +E R R+ + ER+R R R RD+ G + R SR R+ Sbjct: 1276 EREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRS 1329 Score = 31.2 bits (69), Expect = 2.5 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 +E + + + R+ + ERER+R R + S D+E+ R R RDR GD+D Sbjct: 1253 KEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERER-ERDR------GDRD 1303 Score = 30.4 bits (67), Expect = 4.2 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -1 Query: 609 KEVDQEAXDRDIRGR-DSDHERERDRAKRHRSRD-KSSGYSDKEKSRHRSSRDRAG 448 +E D+E R R D D +RERDR +R R RD + + + +SR RDR G Sbjct: 1285 RERDRERERERERDRGDRDRDRERDR-ERGRERDRRDTKRHSRSRSRSTPVRDRGG 1339 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHER----ERDRAKRH-RSRDKSSGYSDKEKSRHRSSRDR 454 ++ +QE ++ R ++++ ER ER++ + H R RD+ ++E+ R R RDR Sbjct: 1250 KRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRE---RERERERDRGDRDR 1304
>K0853_HUMAN (Q5T200) Protein KIAA0853| Length = 1668 Score = 37.7 bits (86), Expect = 0.027 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDRA 451 E+ VD+ RD R R+ D ERERDR +R R R++ D+E+ + R R+RA Sbjct: 662 ERRVDRVDDRRDERARERDRERERDR-ERERERERE---RDREREKERELERERA 712 Score = 36.6 bits (83), Expect = 0.059 Identities = 23/53 (43%), Positives = 30/53 (56%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 EKE D+E R RD DH+RER+ R R RD+ +KE+ R R R+R Sbjct: 720 EKERDRE------RDRDRDHDRERE---RERERDR-----EKEREREREERER 758 Score = 36.6 bits (83), Expect = 0.059 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E+++E R R+ + +RERDR + H + D+EK R R +R Sbjct: 704 ERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREER 756 Score = 33.5 bits (75), Expect = 0.50 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = -1 Query: 612 EKEVDQEAX---DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E D+E +R+ R R+ + ERER+R +R R R+++ DKE+ R R D+ Sbjct: 740 ERERDREKEREREREERERERERERERER-ERERERERAR-ERDKERERQRDWEDK 793 Score = 32.3 bits (72), Expect = 1.1 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 594 EAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 E RD + R D ER+R++ + RS + + SRH SS ++G Sbjct: 291 EEKTRDGKDRGRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSG 339 Score = 32.0 bits (71), Expect = 1.5 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E D+E R+ ERER+R K R R RD+ + D+E+ R R RDR Sbjct: 694 ERERDREREKERELERERAREREREREKERDRERDRDRDH-DRERERER-ERDR 745 Score = 31.6 bits (70), Expect = 1.9 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++E R R+ ER+++R ++ DK G D+ + R DR Sbjct: 759 ERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDR 811 Score = 31.6 bits (70), Expect = 1.9 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHR 469 D+ A +RD R R+ D ERER+R + R R R+K ++E++R R Sbjct: 673 DERARERD-RERERDRERERERERERDREREKEREL-ERERARER 715 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 +++ D+E R R+ + ERER+ +R R R++ ++E+ R R R+RA Sbjct: 730 DRDHDRERERERERDREKEREREREERERERERER-----ERERERER-ERERA 777 Score = 30.0 bits (66), Expect = 5.6 Identities = 20/53 (37%), Positives = 31/53 (58%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E D+E R RD + E+ER+ +R R+R++ ++EK R R RDR Sbjct: 682 ERERDRERERERERERDREREKERE-LERERARERE---REREKERDR-ERDR 729
>DHX8_HUMAN (Q14562) ATP-dependent RNA helicase DHX8 (EC 3.6.1.-) (DEAH box| protein 8) (RNA helicase HRH1) Length = 1220 Score = 37.7 bits (86), Expect = 0.027 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 6/69 (8%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDR--AKRHRSRDKSSGYS---DKEKSRHRS-SRDRA 451 +K+ + DR+ R RD D ER RDR +RHRSR +S + +K KSR+RS SR ++ Sbjct: 172 KKKKRSRSRDRN-RDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRSRSRSQS 230 Query: 450 GYYSSGDKD 424 D+D Sbjct: 231 PPKDRKDRD 239 Score = 29.3 bits (64), Expect = 9.5 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYS-DKEKSRHRSSRDR 454 RD++H + KR RSRD++ D+E++R R + R Sbjct: 163 RDAEHRDRTKKKKRSRSRDRNRDRDRDRERNRDRDHKRR 201
>DDX23_PONPY (Q5RC67) Probable ATP-dependent RNA helicase DDX23 (EC 3.6.1.-)| (DEAD box protein 23) Length = 820 Score = 37.7 bits (86), Expect = 0.027 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -1 Query: 594 EAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA-GYYSSGDKD 424 ++ +R+ R ++ + ++ERDR K+ R RDK DK++ R S R + S D+D Sbjct: 66 KSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRD 123 Score = 34.7 bits (78), Expect = 0.23 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 10/60 (16%) Frame = -1 Query: 573 RGRDSDHERERDR---------AKRHRSRDKSSGYSDKEKSRHRS-SRDRAGYYSSGDKD 424 R R D ER+RDR KRHRSRD+ G S + +SR RS S +R + ++D Sbjct: 22 RSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGS-RSRSRSRSKSAERERRHKERERD 80 Score = 32.0 bits (71), Expect = 1.5 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R + ++ ER +R + RD++ D++K HR +DR Sbjct: 64 RSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDR 103 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 13/76 (17%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKSSGYS--------DKEKSRH 472 ++E D++ + +D R RDR + R RSR KS+ DKE+ R+ Sbjct: 27 DRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRN 86 Query: 471 RSSRDRAGYYSSGDKD 424 + RDR DKD Sbjct: 87 KKDRDRDKDGHRRDKD 102 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 591 AXDRDIRGRDSDHERERDRA---KRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 A +D S ER+R R +R R RD+ S S K++ RHRS R G Sbjct: 6 ADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPS-KDRKRHRSRDRRRG 55
>DDX23_HUMAN (Q9BUQ8) Probable ATP-dependent RNA helicase DDX23 (EC 3.6.1.-)| (DEAD box protein 23) (100 kDa U5 snRNP-specific protein) (U5-100kD) (PRP28 homolog) Length = 820 Score = 37.7 bits (86), Expect = 0.027 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -1 Query: 594 EAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA-GYYSSGDKD 424 ++ +R+ R ++ + ++ERDR K+ R RDK DK++ R S R + S D+D Sbjct: 66 KSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRD 123 Score = 34.7 bits (78), Expect = 0.23 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 10/60 (16%) Frame = -1 Query: 573 RGRDSDHERERDR---------AKRHRSRDKSSGYSDKEKSRHRS-SRDRAGYYSSGDKD 424 R R D ER+RDR KRHRSRD+ G S + +SR RS S +R + ++D Sbjct: 22 RSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGS-RSRSRSRSKSAERERRHKERERD 80 Score = 32.0 bits (71), Expect = 1.5 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R + ++ ER +R + RD++ D++K HR +DR Sbjct: 64 RSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDR 103 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 13/76 (17%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKSSGYS--------DKEKSRH 472 ++E D++ + +D R RDR + R RSR KS+ DKE+ R+ Sbjct: 27 DRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRN 86 Query: 471 RSSRDRAGYYSSGDKD 424 + RDR DKD Sbjct: 87 KKDRDRDKDGHRRDKD 102 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 591 AXDRDIRGRDSDHERERDRA---KRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 A +D S ER+R R +R R RD+ S S K++ RHRS R G Sbjct: 6 ADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPS-KDRKRHRSRDRRRG 55
>CPSF6_BRARE (Q6NWC6) Cleavage and polyadenylation specificity factor 6| Length = 545 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRSSRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 487 RSRERDHSRSREKSRRHKSRSRDRHEDYYRERSRERDRHR-ERDR 530 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 R R D+ RER R + RHR RD+ D+E+ R R R Sbjct: 508 RDRHEDYYRERSRERDRHRERDR-----DRERDREREREYR 543
>MOG5_CAEEL (Q09530) Probable pre-mRNA-splicing factor ATP-dependent RNA| helicase mog-5 (EC 3.6.1.-) (Sex determination protein mog-5) (Masculinization of germ line protein 5) Length = 1200 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKE-KSRHRSSRDR 454 DRD R R E RDR +R R RD+ G D+ R R RDR Sbjct: 175 DRDRRRRSRSREDRRDRDRRDRDRDRDRGRGDRRGDDRQRDRRDR 219 Score = 31.2 bits (69), Expect = 2.5 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHER------ERDRAKRHRSRD--KSSGYSDKEKSRHRSSRD 457 +KE D + R R D +R +RDR +R RSR+ + D+++ R R D Sbjct: 147 QKESDSKRNRSRSRSRSRDRKRRRSRSGDRDRRRRSRSREDRRDRDRRDRDRDRDRGRGD 206 Query: 456 RAG 448 R G Sbjct: 207 RRG 209
>CWC25_ASPFU (Q4X1D7) Pre-mRNA-splicing factor cwc25| Length = 447 Score = 37.4 bits (85), Expect = 0.035 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGY---SDKEKSRHRSSRDRAGYYSS 436 Q D+D RD D ER RDR R RSRD+ + +++ HRS R R+ + S Sbjct: 163 QHIRDKD---RDRDRERRRDRGDRDRSRDRDRSHRRSRHEDEDAHRSHRHRSHRHRS 216
>CPSF6_PONPY (Q5NVH8) Cleavage and polyadenylation specificity factor 6| Length = 552 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRSSRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 494 RSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHR-DRDR 537
>CPSF6_MOUSE (Q6NVF9) Cleavage and polyadenylation specificity factor 6| Length = 551 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRSSRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 493 RSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHR-DRDR 536
>CPSF6_HUMAN (Q16630) Cleavage and polyadenylation specificity factor 6| (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Pre-mRNA cleavage factor Im 68-kDa subunit) (Protein HPBRII-4/7) Length = 551 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRSSRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 493 RSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHR-DRDR 536
>CPSF6_CHICK (Q5ZL34) Cleavage and polyadenylation specificity factor 6| Length = 551 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRSSRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 493 RSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHR-DRDR 536
>CPSF6_XENLA (Q6DDW4) Cleavage and polyadenylation specificity factor 6| Length = 548 Score = 37.4 bits (85), Expect = 0.035 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = -1 Query: 573 RGRDSDHERERDRAKRH--RSRDKSSGY---SDKEKSRHRS-SRDR 454 R R+ DH R R++++RH RSRD+ Y +E+ RHR RDR Sbjct: 490 RSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRERDR 535
>CROP_PONPY (Q5R8W6) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 37.0 bits (84), Expect = 0.045 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 10/63 (15%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA------KRHRSRDK-SSGYSDKEKSR---HRSS 463 EKE ++E +R+ + R + ERE++RA KR RSR + SS SD+ SR H+ S Sbjct: 258 EKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRS 317 Query: 462 RDR 454 R R Sbjct: 318 RSR 320 Score = 33.1 bits (74), Expect = 0.66 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ + +E +R+ R + ERER+R +R R R + +KE++R R R R+ Sbjct: 244 DERLKKEKQEREER----EKEREREREERERKRRREEEEREKERARDRERRKRS 293 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKR-HRSRDKSSGYS---DKEKSRHRS-SRDRAGYYSSGDKD 424 R R RD R DR++R HRSR + S D++ +HRS SRDR S +K+ Sbjct: 323 RRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE 380 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYS-DKEKSRHRS-SRDR 454 R RD R R+R +R RSRD+ S D+ + +HRS SRDR Sbjct: 310 RSRDHKRSRSRER-RRSRSRDRRRSRSHDRSERKHRSRSRDR 350 Score = 30.0 bits (66), Expect = 5.6 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -1 Query: 573 RGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 R RD + RDR R +SRD+ KEK + R S D+ SG ++ Sbjct: 346 RSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKEK-RGSDDKKSSVKSGSRE 397
>CROP_MOUSE (Q5SUF2) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 37.0 bits (84), Expect = 0.045 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 10/63 (15%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA------KRHRSRDK-SSGYSDKEKSR---HRSS 463 EKE ++E +R+ + R + ERE++RA KR RSR + SS SD+ SR H+ S Sbjct: 258 EKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRS 317 Query: 462 RDR 454 R R Sbjct: 318 RSR 320 Score = 33.1 bits (74), Expect = 0.66 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYS-DKEKSRHRS-SRDR 454 R RD R RDR +R RSRD+ S D+ + +HRS SRDR Sbjct: 310 RSRDHKRSRSRDR-RRSRSRDRRRSRSHDRSERKHRSRSRDR 350 Score = 33.1 bits (74), Expect = 0.66 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ + +E +R+ R + ERER+R +R R R + +KE++R R R R+ Sbjct: 244 DERLKKEKQEREER----EKEREREREERERKRRREEEEREKERARDRERRKRS 293 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKR-HRSRDKSSGYS---DKEKSRHRS-SRDRAGYYSSGDKD 424 R R RD R DR++R HRSR + S D++ +HRS SRDR S +K+ Sbjct: 323 RRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE 380
>CROP_HUMAN (O95232) Cisplatin resistance-associated overexpressed protein| (cAMP regulatory element associated protein 1) (CRE-associated protein 1) (CREAP-1) (Luc7A) (Okadaic acid-inducible phosphoprotein OA48-18) Length = 432 Score = 37.0 bits (84), Expect = 0.045 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 10/63 (15%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA------KRHRSRDK-SSGYSDKEKSR---HRSS 463 EKE ++E +R+ + R + ERE++RA KR RSR + SS SD+ SR H+ S Sbjct: 258 EKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRS 317 Query: 462 RDR 454 R R Sbjct: 318 RSR 320 Score = 33.1 bits (74), Expect = 0.66 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ + +E +R+ R + ERER+R +R R R + +KE++R R R R+ Sbjct: 244 DERLKKEKQEREER----EKEREREREERERKRRREEEEREKERARDRERRKRS 293 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKR-HRSRDKSSGYS---DKEKSRHRS-SRDRAGYYSSGDKD 424 R R RD R DR++R HRSR + S D++ +HRS SRDR S +K+ Sbjct: 323 RRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE 380 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYS-DKEKSRHRS-SRDR 454 R RD R R+R +R RSRD+ S D+ + +HRS SRDR Sbjct: 310 RSRDHKRSRSRER-RRSRSRDRRRSRSHDRSERKHRSRSRDR 350 Score = 30.0 bits (66), Expect = 5.6 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -1 Query: 573 RGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 R RD + RDR R +SRD+ KEK + R S D+ SG ++ Sbjct: 346 RSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKEK-RGSDDKKSSVKSGSRE 397
>CROP_BOVIN (Q3SX41) Cisplatin resistance-associated overexpressed protein| Length = 432 Score = 37.0 bits (84), Expect = 0.045 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 10/63 (15%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA------KRHRSRDK-SSGYSDKEKSR---HRSS 463 EKE ++E +R+ + R + ERE++RA KR RSR + SS SD+ SR H+ S Sbjct: 258 EKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRS 317 Query: 462 RDR 454 R R Sbjct: 318 RSR 320 Score = 33.1 bits (74), Expect = 0.66 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ + +E +R+ R + ERER+R +R R R + +KE++R R R R+ Sbjct: 244 DERLKKEKQEREER----EKEREREREERERKRRREEEEREKERARDRERRKRS 293 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKR-HRSRDKSSGYS---DKEKSRHRS-SRDRAGYYSSGDKD 424 R R RD R DR++R HRSR + S D++ +HRS SRDR S +K+ Sbjct: 323 RRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE 380 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYS-DKEKSRHRS-SRDR 454 R RD R R+R +R RSRD+ S D+ + +HRS SRDR Sbjct: 310 RSRDHKRSRSRER-RRSRSRDRRRSRSHDRSERKHRSRSRDR 350
>RU17_XENTR (Q66II8) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 37.0 bits (84), Expect = 0.045 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSR-HRSSRDR 454 EK D++ + RD D +R+RDR + HR R++ D+E+ R R RDR Sbjct: 352 EKNRDRDRERDREKDRDKDRDRDRDRRRSHRDRERD---KDRERDRDRRRDRDR 402 Score = 37.0 bits (84), Expect = 0.045 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 RD D ERERDR +R R RDK ++ +SR R R R+ Sbjct: 222 RDRDRERERDRRERSRERDKE---RERRRSRSRERRRRS 257 Score = 35.0 bits (79), Expect = 0.17 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Frame = -1 Query: 612 EKEVDQEAX-DRDIRGRDSDHERER------DRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E++ D+E DR R R+ D ERER +R +R RSR+K +E+SR + Sbjct: 221 ERDRDRERERDRRERSRERDKERERRRSRSRERRRRSRSREKEERKRSRERSRDKDKDKD 280 Query: 453 AGYYSSGDKD 424 DKD Sbjct: 281 KDKDKEKDKD 290 Score = 34.7 bits (78), Expect = 0.23 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDRAGYYSSGDKD 424 D R + D +RER+R +R RSR++ DKE+ R RS SR+R S +K+ Sbjct: 214 DDTSRYDERDRDRERERDRRERSRER-----DKERERRRSRSRERRRRSRSREKE 263 Score = 32.0 bits (71), Expect = 1.5 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 6/59 (10%) Frame = -1 Query: 612 EKEVDQEAX-DRDIR----GRDSDHERERDRAKRHRSRDKSSGYSDKEKSR-HRSSRDR 454 EK+ D++ DRD R R+ D +RERDR +R R RD+ D+++ R H+ RDR Sbjct: 364 EKDRDKDRDRDRDRRRSHRDRERDKDRERDRDRR-RDRDR-----DRDRDRDHKRERDR 416 Score = 31.6 bits (70), Expect = 1.9 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDK 508 DRD R RD DH+RERDR R R++ Sbjct: 401 DRD-RDRDRDHKRERDRGDRGEKREE 425 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 7/56 (12%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYS-------DKEKSRHRSSRDRA 451 + + R+ R R E+E + R RSRDK DK+K R R R R+ Sbjct: 246 RRSRSRERRRRSRSREKEERKRSRERSRDKDKDKDKDKDKEKDKDKDRDRKRRSRS 301 Score = 29.6 bits (65), Expect = 7.2 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRD-KSSGYSDKEKSRHR 469 E+ D++ + ++ D +++RDR +R RSR+ K D+EK R Sbjct: 270 ERSRDKDKDKDKDKDKEKDKDKDRDRKRRSRSRERKRERDRDREKKEDR 318 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 EKE + + +R R +D D ++++D+ K + + RD+ +E+ R R RDR Sbjct: 261 EKEERKRSRERS-RDKDKDKDKDKDKEKDKDKDRDRKRRSRSRERKRER-DRDR 312
>RU17_HUMAN (P08621) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 437 Score = 37.0 bits (84), Expect = 0.045 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 D+ + RD D +RER+R +R R RDK ++E+ R R SRDR S DK+ Sbjct: 220 DERPGPSPLPHRDRDRDRERERRERSRERDK-----ERERRRSR-SRDRRRRSRSRDKE 272 Score = 35.8 bits (81), Expect = 0.10 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 6/59 (10%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERER------DRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 +++ D+E R+ R R+ D ERER DR +R RSRDK +E+S+ + RDR Sbjct: 232 DRDRDRERERRE-RSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDK-DRDR 288 Score = 35.0 bits (79), Expect = 0.17 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHE-RERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 +E D+E R R RD R RD+ +R RSR++S K R SR+RA Sbjct: 246 RERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERA 299 Score = 31.2 bits (69), Expect = 2.5 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Frame = -1 Query: 573 RGRDSDHERER-----DRAK-----RHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 R RD D ERER +R K R RSRD+ ++K R SR+R S DKD Sbjct: 231 RDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER-----SKDKD 285
>PRP5_CRYNE (Q5KME7) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 1072 Score = 36.6 bits (83), Expect = 0.059 Identities = 21/53 (39%), Positives = 29/53 (54%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E D+ RD R RD D++R RD+ R+R D+ D + R R RDR Sbjct: 54 ERERDRT---RDYRDRDRDYDRRRDK-DRYRDDDRDRRRRDDKDDRRREERDR 102 Score = 33.1 bits (74), Expect = 0.66 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR-SSRDR 454 R R+ D ERERDR + +R RD+ ++K R+R RDR Sbjct: 47 RDRERDRERERDRTRDYRDRDRDYD-RRRDKDRYRDDDRDR 86
>RU17_ARATH (Q42404) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 427 Score = 36.6 bits (83), Expect = 0.059 Identities = 26/103 (25%), Positives = 40/103 (38%), Gaps = 7/103 (6%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA-------KRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E +E R R+ HE+ R+R+ K HR RD+ D++ R R Sbjct: 264 EREKSREKGKERERSRELSHEQPRERSRDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRD 323 Query: 453 AGYYSSGDKDXXXXXXXXXXXSVL*EHPQREHEGPDGA*EGSG 325 G D+D +R++EG + EG G Sbjct: 324 RGDRDRRDRDRGRDRTSRDHDRDRSRKKERDYEGGEYEHEGGG 366 Score = 29.6 bits (65), Expect = 7.2 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 15/78 (19%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKE-------KSRHRSSRDR 454 +++ ++ DRD R RD +R R RSR K Y E +SR R + R Sbjct: 317 DRDRTRDRGDRDRRDRDRGRDRTSRDHDRDRSRKKERDYEGGEYEHEGGGRSRERDAEYR 376 Query: 453 A------GYY--SSGDKD 424 GYY GD D Sbjct: 377 GEPEETRGYYEDDQGDTD 394
>FIP1_HUMAN (Q6UN15) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| (Factor interacting with PAP) (hFip1) (Rearranged in hypereosinophilia) Length = 594 Score = 36.6 bits (83), Expect = 0.059 Identities = 28/61 (45%), Positives = 37/61 (60%), Gaps = 5/61 (8%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSG----YSDKEKSRHRSSRDRAG 448 EK+ D+E DRD R RD D +RER+R + R R RD S SD+E+ R+R +R G Sbjct: 458 EKDRDRER-DRD-RERDRDRDRERERTRERERERDHSPTPSVFNSDEERYRYREYAER-G 514 Query: 447 Y 445 Y Sbjct: 515 Y 515 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 555 HERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 H R++ +RHR R + +KE++RH+SSR + Sbjct: 518 HRASREKEERHRERR----HREKEETRHKSSRSNS 548
>RSP7_CAEEL (O01159) Probable splicing factor, arginine/serine-rich 7 (p54)| Length = 452 Score = 36.6 bits (83), Expect = 0.059 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = -1 Query: 582 RDIRGRDSDHERERDRA--KRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 RD R RD D +R+R R+ +R RSRD+ D+++SR R + R+ + D+D Sbjct: 290 RDSRDRDRDRDRDRRRSRDRRSRSRDRDRD-RDRKRSRSRDRKRRSRSRDNKDRD 343 Score = 36.2 bits (82), Expect = 0.077 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 DRD R RD R RDR +R RSRD D+++SR R R R+ Sbjct: 315 DRD-RDRDRKRSRSRDRKRRSRSRDNKD--RDRKRSRSRDRRRRS 356 Score = 34.3 bits (77), Expect = 0.29 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 9/57 (15%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYS---------DKEKSRHRSSRDR 454 + + RD + RD R RDR +R +SRD+ S DK++SR RS R Sbjct: 332 RRSRSRDNKDRDRKRSRSRDRRRRSKSRDRKRERSRSRSKDRKRDKKRSRSRSPEKR 388 Score = 34.3 bits (77), Expect = 0.29 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = -1 Query: 573 RGRDS-DHERERDRAKRHRSRDKSSGYSDKEKSRHRS---SRDR 454 R RDS D +R+RDR +R RSRD+ S D+++ R R SRDR Sbjct: 288 RRRDSRDRDRDRDRDRR-RSRDRRSRSRDRDRDRDRKRSRSRDR 330
>FIP1_PONPY (Q5RAA7) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 588 Score = 36.6 bits (83), Expect = 0.059 Identities = 28/61 (45%), Positives = 37/61 (60%), Gaps = 5/61 (8%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSG----YSDKEKSRHRSSRDRAG 448 EK+ D+E DRD R RD D +RER+R + R R RD S SD+E+ R+R +R G Sbjct: 452 EKDRDRER-DRD-RERDRDRDRERERTRERERERDHSPTPSVFNSDEERYRYREYAER-G 508 Query: 447 Y 445 Y Sbjct: 509 Y 509 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 555 HERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 H R++ +RHR R + +KE++RH+SSR + Sbjct: 512 HRASREKEERHRERR----HREKEETRHKSSRSNS 542
>RBM5_HUMAN (P52756) RNA-binding protein 5 (RNA-binding motif protein 5)| (Putative tumor suppressor LUCA15) (G15 protein) (NY-REN-9 antigen) Length = 815 Score = 36.2 bits (82), Expect = 0.077 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRD-KSSGYSDKEKSRHRSSRDRAGYYSSGD 430 D++ + R RDSD++R D + R D + ++E+ R S R GY+S GD Sbjct: 24 DRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSPERERERRNSDRSEDGYHSDGD 81
>U2AF2_CAEBR (P90727) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) (U2AF65) Length = 488 Score = 35.8 bits (81), Expect = 0.10 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 RD D E DR KR RSR + G D+++SR R RDR Sbjct: 48 RDRDDE---DRKKRKRSRSRDRGDRDRKRSRSRDRRDR 82 Score = 32.0 bits (71), Expect = 1.5 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 +++ + + RD RD R RDR R RSR + +++SR R+ DR G Sbjct: 54 DRKKRKRSRSRDRGDRDRKRSRSRDRRDRDRSRSRE---RRRDRSRDRNRDDRRG 105 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR---SSRDRAGYYSS 436 E ++ D D + R R+R R RSR + D+ +SR R SRDR Sbjct: 45 EEKRDRDDEDRKKRKRSRSRDRGDRDRKRSRSRDRRDRDRSRSRERRRDRSRDRNRDDRR 104 Query: 435 GDKD 424 G +D Sbjct: 105 GGRD 108
>NELFE_HUMAN (P18615) Negative elongation factor E (NELF-E) (RD protein)| Length = 380 Score = 35.8 bits (81), Expect = 0.10 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRAGYYSS 436 E+ D++ R RD D +RERDR + R R RD+ D+++ R R RDR G + Sbjct: 193 ERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRE---RDRDRERDR-DRDREGPFRR 248 Query: 435 GD 430 D Sbjct: 249 SD 250 Score = 32.7 bits (73), Expect = 0.86 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 R RD HER RDR + R R RD+ D+E+ R R RDR Sbjct: 186 RSRDRSHERNRDRDRDRERDRDRDRD-RDRERDRDR-DRDR 224
>PRP5_YARLI (Q6CCZ1) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 974 Score = 35.4 bits (80), Expect = 0.13 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ D+ RD+R RD D +R+R+R + R RD+ S + + R SRDR+ Sbjct: 27 DRSRDERDRFRDVRDRDRDRDRDRERDRGGYRQDPRDRRYSRSRERERRGSGSRDRS 83
>U2AFM_HUMAN (Q15696) U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa| subunit related-protein 2 (U2(RNU2) small nuclear RNA auxillary factor 1-like 2) (NY-REN-20 antigen) Length = 482 Score = 35.4 bits (80), Expect = 0.13 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA-GYYSSGDKD 424 RGR+ D R+R R + RSR +S + SSR R+ G SG++D Sbjct: 423 RGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRD 473 Score = 34.3 bits (77), Expect = 0.29 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 +++ R + R+ + R R R R RSRD+S G + +SR RS R R S + Sbjct: 405 KKSHKRTSKSRERHNSRSRGR-NRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSR 460
>RBM16_HUMAN (Q9UPN6) Putative RNA-binding protein 16 (RNA-binding motif protein| 16) Length = 1271 Score = 35.0 bits (79), Expect = 0.17 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA-KRHRSRDKSSGYSDKEKSRHRS-SRDR 454 E+ +QEA +R R H R R R+ ++ RSR +S K + R RS SR+R Sbjct: 384 EEVFEQEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSRER 438
>DDX3Y_PANTR (Q6GVM6) ATP-dependent RNA helicase DDX3Y (EC 3.6.1.-) (DEAD box| protein 3, Y-chromosomal) Length = 660 Score = 34.7 bits (78), Expect = 0.23 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 5/68 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRH-----RSRDKSSGYSDKEKSRHRSSRDRAG 448 + E+DQ+ + D+ R R+ R+R+ S G+ DK+ S S+D+ Sbjct: 9 DPELDQQLANLDLNSEKQSGGASRASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDA 68 Query: 447 YYSSGDKD 424 Y S G +D Sbjct: 69 YNSFGSRD 76
>CWC25_NEUCR (Q7SI59) Pre-mRNA-splicing factor cwc-25| Length = 444 Score = 34.7 bits (78), Expect = 0.23 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 12/61 (19%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHR---SRDKSSGYS---------DKEKSRHRSSRD 457 D+ D R RDS +R+RDR R R SRD+S S D+ K R R S D Sbjct: 199 DRHRDRDDDRDRDSARDRDRDRHSRRRRSDSRDRSRSRSPRRRSDSEEDRSKQRRRDSPD 258 Query: 456 R 454 R Sbjct: 259 R 259 Score = 29.3 bits (64), Expect = 9.5 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHR-----SRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 DRD + +R+ DR++RHR SR +S + R SR+R S +D Sbjct: 264 DRDQSRSRGNRDRDDDRSRRHRFPQGRSRSRSGSPGGRSSRRREYSRERDSGGPSSRRD 322
>BRE1A_MOUSE (Q5DTM8) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 973 Score = 34.7 bits (78), Expect = 0.23 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++ +R+ R R+ + ERER++ K S + DKEK +H R + Sbjct: 568 ERERREKERERE-REREKEKEREREKQKLKESEKERDSVKDKEKGKHDDGRKK 619
>LC7L2_MOUSE (Q7TNC4) Putative RNA-binding protein Luc7-like 2 (CGI-74 homolog)| Length = 392 Score = 34.7 bits (78), Expect = 0.23 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 R R S +R R+R+KR S+++ + R RSSRDR+ Sbjct: 318 RSRHSSRDRSRERSKRRSSKERFRDQDLASRDRDRSSRDRS 358 Score = 32.0 bits (71), Expect = 1.5 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 R R RER R R +SR+K + + SR RS + +SS D+ Sbjct: 278 RHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDR 326 Score = 30.4 bits (67), Expect = 4.2 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 18/59 (30%) Frame = -1 Query: 573 RGRDSDHERERDRA---------------KRHRSRDKSSGYS---DKEKSRHRSSRDRA 451 R R +H R R R+ KRHR R +SS S ++SRH SSRDR+ Sbjct: 270 RSRSREHRRHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRH-SSRDRS 327
>NELFE_MOUSE (P19426) Negative elongation factor E (NELF-E) (RD protein)| Length = 375 Score = 34.7 bits (78), Expect = 0.23 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -1 Query: 612 EKEVDQEAX-DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSS 436 +KE D++ DRD R RD D +R+RDR R + RD+ D+++ R R RDR G + Sbjct: 201 DKERDRDRDRDRD-RDRDKDKDRDRDR-DRDKERDR-----DRDRDRDR-ERDREGPFRR 252 Query: 435 GD 430 D Sbjct: 253 SD 254 Score = 31.2 bits (69), Expect = 2.5 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -1 Query: 573 RGRDSDHERERDR---AKRHRSRDKSSGYS-DKEKSRHRSSRDR 454 R RD H+R RDR +R R RD+ DK+K R R RDR Sbjct: 186 RSRDRSHDRSRDRDRDKERDRDRDRDRDRDRDKDKDRDR-DRDR 228
>PPIL4_USTMA (P0C196) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 551 Score = 34.7 bits (78), Expect = 0.23 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSR-DKSSGYSDKEKSRHRSSR 460 ++ ++ DRD RD D +R+RDR + HR R + + D+++SR S R Sbjct: 503 DRRSERSRHDRD---RDRDRDRDRDREREHRRRTEDRRRHDDRQRSRDGSRR 551 Score = 30.0 bits (66), Expect = 5.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 RD D ER R R R RD+ D+E+ R + DR Sbjct: 500 RDEDRRSERSRHDRDRDRDRDRD-RDREREHRRRTEDR 536
>STC_DROME (P40798) Protein shuttle craft| Length = 1106 Score = 34.3 bits (77), Expect = 0.29 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = -1 Query: 612 EKEVDQEAX-DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR-DRAGYYS 439 E+E ++E DRD R RD D +R+RDR R R RD+ S + + R R DR Y Sbjct: 234 ERERERERDRDRD-RERDRDRDRDRDR-DRDRDRDRDSRPGNTRQQRRSDYRDDREDRYE 291 Query: 438 SGDK 427 D+ Sbjct: 292 RSDR 295 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRH-RSSRDR 454 ++E D++ DRD R RD D +R+RD + + + S Y D + R+ RS R R Sbjct: 246 DRERDRDR-DRD-RDRDRDRDRDRDSRPGNTRQQRRSDYRDDREDRYERSDRRR 297 Score = 29.3 bits (64), Expect = 9.5 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 QE +R + S+H ER+R +R R RD+ D+E+ R R RDR Sbjct: 217 QEPAERGANNQCSNHNYERER-ERERDRDR-----DRERDRDR-DRDR 257
>CACB2_HUMAN (Q08289) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) (Lambert-Eaton myasthenic syndrome antigen B) (MYSB) Length = 660 Score = 34.3 bits (77), Expect = 0.29 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDH--ERERDRAKRHRSRD----KSSGYSDKEKSRHRSSRDR 454 VD A RD RD H R R RHRSRD + +K++SRH+ S+DR Sbjct: 579 VDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHK-SKDR 633
>BRE1A_HUMAN (Q5VTR2) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 975 Score = 34.3 bits (77), Expect = 0.29 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++ +R+ R R+ + ERER++ K S + DKEK +H R + Sbjct: 570 ERERREKERERE-REREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKK 621 Score = 30.0 bits (66), Expect = 5.6 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 ++ +R+ R+ + ERER+R K + + EK R + G + G K Sbjct: 564 RDEEERERERREKEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRK 620 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -1 Query: 579 DIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 +I+ + + ERER+R ++ R R++ +KEK R R + Sbjct: 559 EIKSKRDEEERERERREKERERERE---REKEKEREREKQ 595
>TRSF_DROME (P11596) Female-specific protein transformer| Length = 197 Score = 34.3 bits (77), Expect = 0.29 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -1 Query: 567 RDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 R+S H R R R++ R+RSR +SS +++SR RSS R Sbjct: 82 RESRHRRHRQRSRSRNRSRSRSSERKRRQRSRSRSSERR 120 Score = 32.0 bits (71), Expect = 1.5 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 15/69 (21%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRD------SDHERERDRAKR---------HRSRDKSSGYSDKEKS 478 E+E + +RD R ++ +D RE+DR +R R+R +S S +S Sbjct: 25 EREYHGRSSERDSRKKEHKIPYFADEVREQDRLRRLRQRAHQSTRRTRSRSRSQSSIRES 84 Query: 477 RHRSSRDRA 451 RHR R R+ Sbjct: 85 RHRRHRQRS 93
>CWC25_EMENI (Q5B0I1) Pre-mRNA-splicing factor cwc25| Length = 415 Score = 34.3 bits (77), Expect = 0.29 Identities = 21/77 (27%), Positives = 29/77 (37%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKDXXXXXXXXXX 394 +GR+ ERER+R RHR + + R SR R+ D+ Sbjct: 168 QGRERHQERERERGHRHRRDSGNDSHRSHRHRRRSRSRSRSPRVEKDDRRHRDR------ 221 Query: 393 XSVL*EHPQREHEGPDG 343 EH +R H DG Sbjct: 222 -----EHDRRSHRDRDG 233 Score = 32.0 bits (71), Expect = 1.5 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -1 Query: 579 DIRGRDSDHERERDRAKRHRSRD-KSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 D R RD D + RDR R RD +SS D + +RDR + +G+ D Sbjct: 274 DRRDRDQDQDYRRDRNSRSSRRDARSSRDRDTDAFGRDRNRDRGSHSRNGNAD 326 Score = 32.0 bits (71), Expect = 1.5 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHR----SRDKSSGYSDKEKSRHRSSRDRAG 448 D+ DR R +D D+ R+R+ R SRD+ + ++++R R S R G Sbjct: 269 DRRRDDRRDRDQDQDYRRDRNSRSSRRDARSSRDRDTDAFGRDRNRDRGSHSRNG 323
>ENT1_SCHPO (O74423) Epsin-1| Length = 706 Score = 34.3 bits (77), Expect = 0.29 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 ++ E ++ RG + +R+RDR + R D + E+SR + RA Y D+D Sbjct: 136 LEDEHALKEARGDSRERDRDRDRTRSSRFDDDDDDRAPYEESRLSRAPSRASRYDDDDRD 195
>RED_HUMAN (Q13123) Protein Red (Protein RER) (IK factor) (Cytokine IK)| Length = 557 Score = 34.3 bits (77), Expect = 0.29 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRH 472 E+E D+E DRD RD + ERERDR +R R RD+ ++EK RH Sbjct: 343 ERERDRER-DRD---RDRERERERDR-ERERERDRE---REEEKKRH 381
>DIDO1_HUMAN (Q9BTC0) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (hDido1) Length = 2240 Score = 34.3 bits (77), Expect = 0.29 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRA 451 KE D+ R R+ D R+RDR++ R R RDK+ D+E+ R R R ++ Sbjct: 2167 KEWDRSRERSRNRERERDRRRDRDRSRSRERDRDKA---RDRERGRDRKDRSKS 2217 Score = 30.4 bits (67), Expect = 4.2 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 7/60 (11%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKS-SGYSDKEKSRHRS-SRDR 454 E+ +++ RG++ D RER R + R R RD+S S D++K+R R RDR Sbjct: 2152 ERSANRDREREADRGKEWDRSRERSRNRERERDRRRDRDRSRSRERDRDKARDRERGRDR 2211
>RSP6_CAEEL (Q18409) Probable splicing factor, arginine/serine-rich 6| (RNA-binding protein srp-1) (CeSRp20) Length = 179 Score = 34.3 bits (77), Expect = 0.29 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKS---SGYSDKEKSRHRSSRDR 454 RGRD +R RDR+ R RSRD+S S ++ +SR RS ++R Sbjct: 115 RGRDRSRDRSRDRS-RDRSRDRSRERSRERERTRSRSRSPQER 156
>TR150_XENLA (Q5BJ39) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 E+++ + + RDS H RER K ++ S K++ +HR +RDR+ SS Sbjct: 726 ERDLKRGKSRESVDSRDSSHSRERSTEKTEKTHKGS-----KKQKKHRRARDRSRSSSSS 780 Query: 432 DK 427 + Sbjct: 781 SQ 782
>TR150_RAT (Q5M7V8) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 E+++ + + RDS H RER K ++ S K++ +HR +RDR+ SS Sbjct: 726 ERDLKRGKSRESVDSRDSSHSRERSTEKTEKTHKGS-----KKQKKHRRARDRSRSSSSS 780 Query: 432 DK 427 + Sbjct: 781 SQ 782
>TR150_MOUSE (Q569Z6) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 E+++ + + RDS H RER K ++ S K++ +HR +RDR+ SS Sbjct: 726 ERDLKRGKSRESVDSRDSSHSRERSTEKTEKTHKGS-----KKQKKHRRARDRSRSSSSS 780 Query: 432 DK 427 + Sbjct: 781 SQ 782
>CWC25_YARLI (Q6C1V6) Pre-mRNA-splicing factor CWC25| Length = 561 Score = 33.9 bits (76), Expect = 0.38 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 +E + RD R R+ ER RDR++ RSRD+S +E+ R R RDR Sbjct: 249 REEGGRSRSRD-RYRNRSRERYRDRSREERSRDRS-----RERLRSRRDRDR 294 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 DR R D RER R++R R RD+ D+++ R RDR SSG Sbjct: 271 DRSREERSRDRSRERLRSRRDRDRDR-----DRDRDR---DRDRDNVQSSG 313 Score = 30.4 bits (67), Expect = 4.2 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKS--RHRSSRDRA 451 DRD R RD D +R+RDR +S +SSG S S RS RDR+ Sbjct: 291 DRD-RDRDRDRDRDRDR-DNVQSSGRSSGRSSVRSSARSERSLRDRS 335 Score = 30.0 bits (66), Expect = 5.6 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKR--------HRSRDKSSGYSDKEKSRHRSSRDRAGYY 442 +++ DR R RD + E ER R +R R+RD S SD ++ +SSR+ Sbjct: 188 EDSRDRRNR-RDMEREGERRRRRRDGERTRRRERNRDPSPSVSDDDRGYRQSSREERDRK 246 Query: 441 SSGDK 427 SS ++ Sbjct: 247 SSREE 251
>CCNL1_MOUSE (Q52KE7) Cyclin-L1 (Cyclin-L) (Cyclin Ania-6a)| Length = 532 Score = 33.9 bits (76), Expect = 0.38 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = -1 Query: 612 EKEVDQEAXDRDIRG--RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 E E Q+A G +DS R A R RSR +S S + + + R R+G YS Sbjct: 370 EPEDRQQASKSPYNGVRKDSKRSRTSRSASRSRSRTRSRSRSHSPRRHYNNRRSRSGTYS 429 Query: 438 SGDKDXXXXXXXXXXXSVL*EHPQREH 358 S + E P+R H Sbjct: 430 SRSRSRSRSHS---------ESPRRHH 447
>CACB2_RABIT (P54288) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) Length = 632 Score = 33.9 bits (76), Expect = 0.38 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERE--RDRAKRHRSRD----KSSGYSDKEKSRHRSSRDR 454 + VD A RD RD H R R RHRSRD + +K++SRH+ S+DR Sbjct: 549 EHVDHYAPHRDHNHRDETHRSSDHRHRETRHRSRDMDREQDHNECNKQRSRHK-SKDR 605
>DHX15_MOUSE (O35286) Putative pre-mRNA-splicing factor ATP-dependent RNA| helicase DHX15 (EC 3.6.1.-) (DEAH box protein 15) Length = 795 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 DRD R D +RERDR R R R+K +KEK S+ Sbjct: 30 DRDREDRSKDRDRERDRGDREREREK-----EKEKELRAST 65 Score = 31.2 bits (69), Expect = 2.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 558 DHERERDRAKRHRSRDKSSGYSDKEKSRHR 469 D ER+RDR R + RD+ D+E+ R + Sbjct: 26 DRERDRDREDRSKDRDRERDRGDREREREK 55 Score = 29.3 bits (64), Expect = 9.5 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -1 Query: 570 GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 G+D + +R+R+ + R R++ G ++E+ + + RA Sbjct: 24 GKDRERDRDREDRSKDRDRERDRGDREREREKEKEKELRA 63
>DHX15_HUMAN (O43143) Putative pre-mRNA-splicing factor ATP-dependent RNA| helicase DHX15 (EC 3.6.1.-) (DEAH box protein 15) (ATP-dependent RNA helicase #46) Length = 795 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 DRD R D +RERDR R R R+K +KEK S+ Sbjct: 30 DRDREDRSKDRDRERDRGDREREREK-----EKEKELRAST 65 Score = 30.8 bits (68), Expect = 3.3 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -1 Query: 570 GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 G+D D +R+R+ + R R++ G ++E+ + + RA Sbjct: 24 GKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRA 63
>PPIL4_CRYNE (Q5KNY5) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 504 Score = 33.9 bits (76), Expect = 0.38 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 D + DRD GRD + +R+R R RSR++ + E+ R R RDR Sbjct: 460 DHDRRDRDRNGRDRERNGDRER-YRERSRER-----ENERYRERDDRDR 502 Score = 32.3 bits (72), Expect = 1.1 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = -1 Query: 567 RDSDHERERDRAKRH---RSRDKSSGYS-DKEKSRH-RSSRDRAG 448 R+ D ERERDR+ R R RD+S D+E+ H R RDR G Sbjct: 426 RERDRERERDRSPRRDRDRERDRSPRRDRDRERDDHDRRDRDRNG 470 Score = 31.2 bits (69), Expect = 2.5 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 ++E D+E +RD R D +RERDR+ R R RD+ D+ + R R+ RDR +G Sbjct: 425 KRERDRER-ERD-RSPRRDRDRERDRSPR-RDRDRERDDHDR-RDRDRNGRDRE---RNG 477 Query: 432 DKD 424 D++ Sbjct: 478 DRE 480
>CCNL1_RAT (Q9R1Q2) Cyclin-L1 (Cyclin-L) (Cyclin Ania-6a)| Length = 527 Score = 33.9 bits (76), Expect = 0.38 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = -1 Query: 612 EKEVDQEAXDRDIRG--RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 E E Q+A G +DS R A R RSR +S S + + + R R+G YS Sbjct: 365 EPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSGTYS 424 Query: 438 SGDKDXXXXXXXXXXXSVL*EHPQREH 358 S + E P+R H Sbjct: 425 SRSRSRSRSHS---------ESPRRHH 442
>CCNL1_HUMAN (Q9UK58) Cyclin-L1 (Cyclin-L)| Length = 526 Score = 33.9 bits (76), Expect = 0.38 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = -1 Query: 612 EKEVDQEAXDRDIRG--RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 E E Q+A G +DS R A R RSR +S S + + + R R+G YS Sbjct: 364 EPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSGTYS 423 Query: 438 SGDKDXXXXXXXXXXXSVL*EHPQREH 358 S + E P+R H Sbjct: 424 SRSRSRSRSHS---------ESPRRHH 441
>TR150_HUMAN (Q9Y2W1) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 955 Score = 33.9 bits (76), Expect = 0.38 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 E+++ + + RDS H RER K ++ S K++ +HR +RDR+ SS Sbjct: 729 ERDLKRGKSRESVDSRDSSHSRERSAEKTEKTHKGS-----KKQKKHRRARDRSRSSSSS 783 Query: 432 DK 427 + Sbjct: 784 SQ 785
>DDX3Y_HUMAN (O15523) ATP-dependent RNA helicase DDX3Y (EC 3.6.1.-) (DEAD box| protein 3, Y-chromosomal) Length = 660 Score = 33.5 bits (75), Expect = 0.50 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIR-----GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 + E+DQ+ + D+ G S + R R+R+ S G+ DK+ S S+D+ Sbjct: 9 DPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDA 68 Query: 447 YYSSGDKD 424 Y S G +D Sbjct: 69 YSSFGSRD 76
>CF151_MOUSE (Q9D361) U11/U12 snRNP 48 kDa protein| Length = 337 Score = 33.5 bits (75), Expect = 0.50 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGD 430 +E+ + R D+ + E R+ SR Y D E SRHR +R R+ + + Sbjct: 250 EELSSHWQEEQGRAGDAAEKNEERRSASVDSRQSGGSYLDVESSRHRRARSRSPHKRKRN 309 Query: 429 KD 424 KD Sbjct: 310 KD 311
>PRP16_HUMAN (Q92620) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16| (EC 3.6.1.-) (ATP-dependent RNA helicase DHX38) (DEAH box protein 38) Length = 1227 Score = 33.5 bits (75), Expect = 0.50 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 + RD D++R+RDR +R RSR S S+++ RSSR Sbjct: 158 KSRDRDYDRKRDRDERDRSRHSSR--SERDGGSERSSR 193
>SFR12_MOUSE (Q8BZX4) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) Length = 494 Score = 33.5 bits (75), Expect = 0.50 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 10/69 (14%) Frame = -1 Query: 612 EKEVDQEAX---DRDIRGRDSDHERERDRAK-------RHRSRDKSSGYSDKEKSRHRSS 463 ++E D+E D+D R ++ DHE+ERD+ K + R +D+S +K K +S Sbjct: 289 DREKDKERGKNKDKD-REKEKDHEKERDKEKEKEQDKDKEREKDRSKETDEKRKKEKKSR 347 Query: 462 RDRAGYYSS 436 Y +S Sbjct: 348 TPPRSYNAS 356 Score = 33.1 bits (74), Expect = 0.66 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS 466 E+E D+E + +D D E+E+D K + DKE+ + RS Sbjct: 285 EREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRS 333 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSR 460 EK+ ++E + +D D ERE+DR+K R ++K S + + R SR Sbjct: 307 EKDHEKERDKEKEKEQDKDKEREKDRSKETDEKRKKEKKSRTPPRSYNASRRSR 360
>DDX3Y_PONPY (Q5RF43) ATP-dependent RNA helicase DDX3Y (EC 3.6.1.-) (DEAD box| protein 3, Y-chromosomal) Length = 658 Score = 33.5 bits (75), Expect = 0.50 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIR-----GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 + E+DQ+ + D+ G S + R R+R+ S G+ DK+ S S+D+ Sbjct: 9 DPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDA 68 Query: 447 YYSSGDKD 424 Y S G +D Sbjct: 69 YSSFGSRD 76
>CD2L5_HUMAN (Q14004) Cell division cycle 2-like protein kinase 5 (EC 2.7.11.22)| (CDC2-related protein kinase 5) (Cholinesterase-related cell division controller) Length = 1512 Score = 33.5 bits (75), Expect = 0.50 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR---SSRDRAGYYSSG 433 R R R S R ++R + HR RD G S+ KSR R S +RA SG Sbjct: 197 RPRRDRRSSSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGEERAEVAKSG 249
>DIDO1_MOUSE (Q8C9B9) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (Fragments) Length = 1956 Score = 33.5 bits (75), Expect = 0.50 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRA 451 KE D+ R RD + R+RDR++ R R RD+ D+++ R R +DR+ Sbjct: 1879 KEWDRSRERSRNRDRDRERRRDRDRSRSRDRDRDRERA-RDRDRDRGRDRKDRS 1931 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = -1 Query: 573 RGRDSDHERERDRAKR-HRSRDKSSGYS-DKEKSRHRS---SRDR 454 R + D ER+ DRAK RSR++S D+E+ R R SRDR Sbjct: 1865 RSSNRDRERDNDRAKEWDRSRERSRNRDRDRERRRDRDRSRSRDR 1909
>SPP2_NEUCR (Q7SBU7) Pre-mRNA-splicing factor spp-2| Length = 358 Score = 33.1 bits (74), Expect = 0.66 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKSSGYSDKEKSRHRSSR 460 D E +RD R D R+RDR + R+R R + + D+++ +RSSR Sbjct: 77 DNELENRDRSDRRRDRSRDRDRDRNRDGDRNRDRRRDNRSQDRDRHNNRSSR 128 Score = 32.7 bits (73), Expect = 0.86 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 10/54 (18%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYS-------DKEKSRHRS---SRDR 454 DRD R RD D R+R R R + RD+ + S D +SR RS SRDR Sbjct: 97 DRD-RNRDGDRNRDRRRDNRSQDRDRHNNRSSRPSRDDDASRSRRRSTSRSRDR 149
>CACB2_BOVIN (Q9MZL5) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) Length = 603 Score = 33.1 bits (74), Expect = 0.66 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 11/64 (17%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERE-------RDRAKRHRSRD----KSSGYSDKEKSRHRS 466 ++E E D RD +H E R R RHRSRD + S+K++SRH+ Sbjct: 514 KEEYSHEHADHYAPHRDHNHREEPHGGGEHRHREPRHRSRDPDREQDHNESNKQRSRHK- 572 Query: 465 SRDR 454 S+DR Sbjct: 573 SKDR 576
>LUC7L_HUMAN (Q9NQ29) Putative RNA-binding protein Luc7-like 1 (SR+89) (Putative| SR protein LUC7B1) Length = 371 Score = 33.1 bits (74), Expect = 0.66 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-----SRDRA 451 R R RDR +RHRSR +S + SR RS SR+RA Sbjct: 288 RKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERA 331 Score = 30.4 bits (67), Expect = 4.2 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKS----RHRSSRDRAGYY 442 R R RER + R RSRD+ + + +S R+SRDR+ Y Sbjct: 277 RRRSRSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKY 324
>SFR11_HUMAN (Q05519) Splicing factor arginine/serine-rich 11 (Arginine-rich 54| kDa nuclear protein) (p54) Length = 484 Score = 33.1 bits (74), Expect = 0.66 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 R + + D ++ER R +R RS K DKEK R R S Sbjct: 373 RHKKEKKKDKDKERSRDERERSTSKKKKSKDKEKDRERKS 412
>PPIL4_NEUCR (Q871A4) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 494 Score = 33.1 bits (74), Expect = 0.66 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 ++ D+ DRD+ RD +R RD R+R RD Y+D++ HR RDR Sbjct: 442 RDADRRRDDRDLDRRDRRGDRSRD---RYRDRD----YNDRD---HRRGRDR 483
>U2AF2_CAEEL (P90978) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) (U2AF65) Length = 496 Score = 33.1 bits (74), Expect = 0.66 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDK-----SSGYSDKEKSRHRSSRDRAG 448 D D + R R+RD +R RSRD+ G D+++SR R R G Sbjct: 55 DNDRKKRKRSRSRDRDTRRRSRSRDRGERRGGGGGGDRDRSRSRERRRGGG 105
>PRP5_ASPFU (Q4WT99) Pre-mRNA-processing ATP-dependent RNA helicase prp5 (EC| 3.6.1.-) Length = 1211 Score = 32.7 bits (73), Expect = 0.86 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 ++ VD+ RD DS RDR++ R RSRD+ + KSR R R R Sbjct: 63 DRSVDRRDDHRD---EDSYRSSRRDRSRDRRRSRDRGDDRDHRRKSRERDYRSR 113 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 ++ D R R RD R+R + HR + + Y +SR SRDRA Sbjct: 73 RDEDSYRSSRRDRSRDRRRSRDRGDDRDHRRKSRERDY----RSRRDDSRDRA 121
>LUC7L_MOUSE (Q9CYI4) Putative RNA-binding protein Luc7-like 1| Length = 371 Score = 32.7 bits (73), Expect = 0.86 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 R R RDR +RHRSR +S + SR RS++ Sbjct: 288 RKFSRSRSRDRYRRHRSRSRSHSRGHRRASRDRSTK 323
>FIP1_MOUSE (Q9D824) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 581 Score = 32.7 bits (73), Expect = 0.86 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 17/70 (24%) Frame = -1 Query: 612 EKEVDQEAX-DRDI-RGRDSDHERERDRAKRHRSRDKSSG---------------YSDKE 484 EK+ D++ DRD R RD D ERER R +R R RD S Y+++ Sbjct: 443 EKDRDRDRERDRDRERERDRDRERERTR-ERERERDHSPTPSVFNSDEERYRYREYAERG 501 Query: 483 KSRHRSSRDR 454 RHR+SR++ Sbjct: 502 YERHRASREK 511 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 555 HERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 H R++ +RHR R + +KE++RH+SSR + Sbjct: 505 HRASREKEERHRERR----HREKEETRHKSSRSNS 535
>LC7L2_HUMAN (Q9Y383) Putative RNA-binding protein Luc7-like 2| Length = 392 Score = 32.7 bits (73), Expect = 0.86 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 R R S +R R+R+KR S+++ R RSSRDR+ Sbjct: 318 RSRHSSRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRS 358 Score = 32.0 bits (71), Expect = 1.5 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 R R RER R R +SR+K + + SR RS + +SS D+ Sbjct: 278 RHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDR 326 Score = 30.4 bits (67), Expect = 4.2 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 18/59 (30%) Frame = -1 Query: 573 RGRDSDHERERDRA---------------KRHRSRDKSSGYS---DKEKSRHRSSRDRA 451 R R +H R R R+ KRHR R +SS S ++SRH SSRDR+ Sbjct: 270 RSRSREHRRHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRH-SSRDRS 327
>FIP1_RAT (Q5U317) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 536 Score = 32.7 bits (73), Expect = 0.86 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 17/70 (24%) Frame = -1 Query: 612 EKEVDQEAX-DRDI-RGRDSDHERERDRAKRHRSRDKSSG---------------YSDKE 484 EK+ D++ DRD R RD D ERER R +R R RD S Y+++ Sbjct: 398 EKDRDRDRERDRDRERERDRDRERERTR-ERERERDHSPTPSVFNSDEERYRYREYAERG 456 Query: 483 KSRHRSSRDR 454 RHR+SR++ Sbjct: 457 YERHRASREK 466 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 555 HERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 H R++ +RHR R + +KE++RH+SSR + Sbjct: 460 HRASREKEERHRERR----HREKEETRHKSSRSNS 490
>CS029_MOUSE (Q9CS00) Protein C19orf29 homolog| Length = 772 Score = 32.7 bits (73), Expect = 0.86 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS 466 R +HER R+R +R R R S ++KSR RS Sbjct: 61 RRREHERRRERKRRSRGRRSDSEGEQRQKSRRRS 94 Score = 32.7 bits (73), Expect = 0.86 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 RGR R R R++ R RSR +S G S + + H R+R Sbjct: 31 RGRSRSRSRSRSRSRSRSRSRSRSHGRSSRRRREHERRRER 71
>RED_MOUSE (Q9Z1M8) Protein Red (Protein RER) (IK factor) (Cytokine IK)| Length = 557 Score = 32.7 bits (73), Expect = 0.86 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 612 EKEVDQEAXDRDI---RGRDSDHERERDRAKRHRSRDKSSGYSDKEK 481 E+E D+E DRD R RD + ERERDR + K Y +K K Sbjct: 343 ERERDRER-DRDRERDRERDRERERERDREREREEEKKRHSYFEKPK 388 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRH 472 ++ ++E R R+ D +RERDR + R R RD+ ++EK RH Sbjct: 334 RDKERERYRERERDRERDRDRERDRERDRERERERDRER-EREEEKKRH 381 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDK 427 R R+ D ER+RDR +R R RD+ ++E+ R R + +S +K Sbjct: 342 RERERDRERDRDR-ERDRERDRE---RERERDREREREEEKKRHSYFEK 386
>ARS2_HUMAN (Q9BXP5) Arsenite-resistance protein 2| Length = 876 Score = 32.3 bits (72), Expect = 1.1 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGY 445 + E D+ D+ R R SD++R R+R +R R D ++D+E R R R R Y Sbjct: 5 DDEYDRRRRDKFRRER-SDYDRSRERDERRRGDD----WNDREWDRGRERRSRGEY 55
>SFR12_RAT (Q9JKL7) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (SR-related protein of 86 kDa) Length = 494 Score = 32.3 bits (72), Expect = 1.1 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSD--------HERERDRAK-------RHRSRDKSSGYSDKEKS 478 EKE ++E RG++ D HE+ERD+ K + R +D+S +K K Sbjct: 283 EKEREKEREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRSKEADEKRKK 342 Query: 477 RHRSSRDRAGYYSS 436 +S Y SS Sbjct: 343 EKKSRTPPRSYNSS 356 Score = 30.0 bits (66), Expect = 5.6 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRA--------KRHRSRDKSSGYSDKEKSRHRSSRD 457 EK+ ++E + +D D ERE+DR+ K +SR Y+ +SR +SR+ Sbjct: 307 EKDHEKERDKEKEKEQDKDKEREKDRSKEADEKRKKEKKSRTPPRSYNSSRRSR-SASRE 365 Query: 456 R 454 R Sbjct: 366 R 366
>PRP5_NEUCR (Q7SH33) Pre-mRNA-processing ATP-dependent RNA helicase prp-5 (EC| 3.6.1.-) Length = 1194 Score = 32.3 bits (72), Expect = 1.1 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 9/71 (12%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRA---KRHRSRDKSSGYSDKEKSRHRSSRDRA---- 451 K D + DRD R DH R R R+ +R+R RD+ G +++ +R RDR+ Sbjct: 20 KRKDDDRRDRDRRDGPVDH-RRRSRSPIDRRYRDRDRDRGRDGRDRDSYR-RRDRSIDRR 77 Query: 450 --GYYSSGDKD 424 YY +D Sbjct: 78 DDDYYRGSRRD 88 Score = 31.6 bits (70), Expect = 1.9 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = -1 Query: 573 RGRDSDHERERDRAKR---HRSRDKSS---GYSDKEKSRHRSSRDRAGY 445 R R D R+RDR HR R +S Y D+++ R R RDR Y Sbjct: 19 RKRKDDDRRDRDRRDGPVDHRRRSRSPIDRRYRDRDRDRGRDGRDRDSY 67
>ARS2_MOUSE (Q99MR6) Arsenite-resistance protein 2| Length = 875 Score = 32.3 bits (72), Expect = 1.1 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGY 445 + E D+ D+ R R SD++R R+R +R R D ++D+E R R R R Y Sbjct: 5 DDEYDRRRRDKFRRER-SDYDRSRERDERRRGDD----WNDREWDRGRERRSRGEY 55
>TOP1_DROME (P30189) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 972 Score = 32.3 bits (72), Expect = 1.1 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERE---RDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYY 442 +K D+E + S E + RD+ RH+S SS + DK+K R SS Sbjct: 54 DKHRDREREHKSSNSSSSSKEHKSSSRDK-DRHKSSSSSSKHRDKDKERDGSSNSHRSGS 112 Query: 441 SSGDKD 424 SS KD Sbjct: 113 SSSHKD 118 Score = 31.2 bits (69), Expect = 2.5 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 12/65 (18%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRS----RDK--------SSGYSDKEKSRHRSSRDRAGYYS 439 +D RD D +R + RH+S RDK SS S KS+H SSR + S Sbjct: 139 KDKERRDKDKDRGSSSSSRHKSSSSSRDKERSSSSHKSSSSSSSSKSKHSSSRHSS---S 195 Query: 438 SGDKD 424 S KD Sbjct: 196 SSSKD 200 Score = 30.0 bits (66), Expect = 5.6 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSG-----YSDKEKSRHRSS 463 + S ++ RDR + H+S + SS S ++K RH+SS Sbjct: 49 KSSSKDKHRDREREHKSSNSSSSSKEHKSSSRDKDRHKSS 88 Score = 29.6 bits (65), Expect = 7.2 Identities = 15/61 (24%), Positives = 25/61 (40%), Gaps = 13/61 (21%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDK-------------SSGYSDKEKSRHRSSRDRAGYYSSGDK 427 RD D + + +HR +DK SS + DK+ S + +G++ K Sbjct: 80 RDKDRHKSSSSSSKHRDKDKERDGSSNSHRSGSSSSHKDKDGSSSSKHKSSSGHHKRSSK 139 Query: 426 D 424 D Sbjct: 140 D 140
>PRP5_EMENI (Q5BDW4) Pre-mRNA-processing ATP-dependent RNA helicase prp5 (EC| 3.6.1.-) Length = 1173 Score = 32.3 bits (72), Expect = 1.1 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 15/55 (27%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSD---------------KEKSRHRSSRDR 454 R RD DH+R+ R R R RD S D K KSR SRDR Sbjct: 90 RSRDRDHDRDYRRRSRSRDRDYRSRRDDSRDRVRRRTDDSADLKRKSRRDDSRDR 144
>PQBP1_HUMAN (O60828) Polyglutamine-binding protein 1 (Polyglutamine| tract-binding protein 1) (PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) Length = 265 Score = 32.3 bits (72), Expect = 1.1 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 600 DQEAXDRDIRGRDS-DHERERDRAK-RHRSRDKSSGYSDKEKSRHR 469 D+ DR+ RG D D ERERDR + R R DK+ KE+ HR Sbjct: 136 DKSDRDRE-RGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR 180 Score = 30.4 bits (67), Expect = 4.2 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 11/74 (14%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRD-SDHERER--------DRAKRHRSRDKSSGYS--DKEKSRHRS 466 E+++D+ + D+ RG D SD E+ DR RD+ GY D+E+ R R Sbjct: 100 EEKLDR-SHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDR- 157 Query: 465 SRDRAGYYSSGDKD 424 RDR Y D++ Sbjct: 158 ERDRDRGYDKADRE 171 Score = 29.6 bits (65), Expect = 7.2 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Frame = -1 Query: 585 DRDIRGRD-SDHERER-----DRAK-RHRSRDKSSGY--SDKEKSRHRSSRDR 454 D+ RG D SD +RER DR + R R RD+ GY +D+E+ + R R Sbjct: 129 DKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRR 181
>BRE1A_CHICK (Q5ZLS3) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 984 Score = 32.3 bits (72), Expect = 1.1 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 579 DIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR 469 +++ R + ERER+R +R R R+K +KEK R R Sbjct: 559 EVKARRDEEERERERREREREREK-----EKEKERER 590 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++E R ++ + E+ER+R K + + +K +KEK +H R + Sbjct: 577 EREREKEKEKEREREKEKEKEKEREREKQKQKESEKERESKEKEKGKHEDGRKK 630 Score = 30.0 bits (66), Expect = 5.6 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 D+E +R+ R R+ + E+E+++ +R R ++K +KEK R R + Sbjct: 565 DEEERERERREREREREKEKEK-EREREKEK-----EKEKEREREKQ 605
>YOW5_CAEEL (P30651) Hypothetical protein ZK643.5| Length = 487 Score = 32.3 bits (72), Expect = 1.1 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRSRDKSSGYSDK----EKSRHRSSRDRAGYYSSGDKD 424 RD R R S + RSR +SS SD+ ++ R R RDR Y G +D Sbjct: 246 RDTRKRRSSSYSSTSSSSDGRSRSRSSSRSDRRRRDDRKRPREDRDRKDYRRDGRRD 302
>PRP5_GIBZE (Q4IP34) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 1227 Score = 32.0 bits (71), Expect = 1.5 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 13/53 (24%) Frame = -1 Query: 573 RGRDSDHERERDRAK---RHRSRDKS----------SGYSDKEKSRHRSSRDR 454 R RD D +R+RDRA+ +R RD+S G D + R SRDR Sbjct: 71 RNRDRDRDRDRDRARDRDNYRRRDRSLDRRDDNHYRGGRRDNRERDRRRSRDR 123
>CYP1_BRUMA (Q27450) Peptidyl-prolyl cis-trans isomerase 1 (EC 5.2.1.8) (PPIase| 1) (Cyclophilin) (BmCYP-1) Length = 843 Score = 32.0 bits (71), Expect = 1.5 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 R R S R R R +RH+SR +S GY + + RS R Sbjct: 713 RRRRSSSRRSRSRDRRHKSRSRSRGYVRRFEGWSRSRR 750
>CF151_HUMAN (Q6IEG0) U11/U12 snRNP 48 kDa protein| Length = 339 Score = 32.0 bits (71), Expect = 1.5 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGD 430 +E+ + + D + E R+ SR Y D E SRHR R R+ + + Sbjct: 250 EELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRN 309 Query: 429 KD 424 KD Sbjct: 310 KD 311
>RSRC1_RAT (Q5PPJ2) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 31.6 bits (70), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 R RD D + RD+ KR + +DK K+K H R G +G Sbjct: 132 RSRDRDRRKVRDKEKREKEKDKG-----KDKEAHTIKRGDCGNIKAG 173
>DDX46_BRARE (Q4TVV3) Probable ATP-dependent RNA helicase DDX46 (EC 3.6.1.-)| (DEAD box protein 46) Length = 1018 Score = 31.6 bits (70), Expect = 1.9 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R + D R ++R RSR + S + K + RSSRDR Sbjct: 31 RSKKDDRTASRTHSRRERSRSRERRRSRERKRQRRSSRDR 70
>VE2_HPV20 (P50766) Regulatory protein E2| Length = 497 Score = 31.6 bits (70), Expect = 1.9 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSRDRAG 448 R R + R R++ RHRSR +S S + +SR+RS G Sbjct: 265 RSRSKSKSKSRSRSRSRHRSRSRSRSESPRRRSRYRSRSGSRG 307
>SFR12_HUMAN (Q8WXA9) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (Splicing regulatory protein 508) (SRrp508) Length = 508 Score = 31.6 bits (70), Expect = 1.9 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRH-RSRDK-SSGYSDKEKSRHR 469 K D++ R +D + +RER+R K H + RDK DKEK R + Sbjct: 297 KNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREK 345 Score = 31.2 bits (69), Expect = 2.5 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 E+E ++E RG++ D ++ER+ + R +DK + + H RD+ Sbjct: 282 EREREKEREKEKERGKNKDRDKERE---KDREKDKEKDREREREKEHEKDRDK 331 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 9/68 (13%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK---------RHRSRDKSSGYSDKEKSRHRSSR 460 E+E D+E R R+ + E E+DR K + R +D+S +K K +S Sbjct: 304 EREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRT 363 Query: 459 DRAGYYSS 436 Y +S Sbjct: 364 PPRSYNAS 371 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK-----RHRSRDKSSGYS-DKEKSRHR 469 E+E ++E + +D D ERE+DR K R R R+K DKEK + + Sbjct: 284 EREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQ 337 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 EKE D+E R ++ D +R++D+ R R ++ + SR R R Sbjct: 334 EKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRR 384 Score = 30.4 bits (67), Expect = 4.2 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAK---RHRSRDKSS-----GYSDKEKSRHRSSRD 457 EKE +++ + +D + ERE+DR+K R +DK S Y+ +SR SSR+ Sbjct: 322 EKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSR-SSSRE 380 Query: 456 R 454 R Sbjct: 381 R 381 Score = 29.6 bits (65), Expect = 7.2 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDK---SSGYSDKEKSRHR 469 EKE +E R R+ + E+E++R K ++ RDK DKEK R R Sbjct: 270 EKERVKEKDREKEREREKEREKEKERGK-NKDRDKEREKDREKDKEKDRER 319
>YLPM1_MOUSE (Q9R0I7) YLP motif-containing protein 1 (Nuclear protein ZAP3)| Length = 1386 Score = 31.6 bits (70), Expect = 1.9 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = -1 Query: 585 DRDIRGRDSDHERER-DRAKRHRSRDKSSGYSDKE--KSRHRSSRDRAGYYSSGDK 427 DRD R R D+ER+R DR +R R D++ Y DK+ S R DR Y D+ Sbjct: 959 DRD-RDRVLDYERDRFDRERRPRD-DRNQSYRDKKDHSSSRRGGFDRPSYDRKSDR 1012
>YTDC1_HUMAN (Q96MU7) YTH domain-containing protein 1 (Putative splicing factor| YT521) Length = 727 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHR-SSRDR 454 R R R+ D ERERDR + R R++ G D+E+ R R RDR Sbjct: 674 RRSRPRERDRERERDRPRDNRRDRERDRG-RDRERERERLCDRDR 717
>YTDC1_RAT (Q9QY02) YTH domain-containing protein 1 (Putative splicing factor| YT521) (RA301-binding protein) Length = 738 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHR-SSRDR 454 R R R+ D ERERDR + R R++ G D+E+ R R RDR Sbjct: 685 RRSRPRERDRERERDRPRDNRRDRERDRG-RDRERERERICDRDR 728
>TOP1_MOUSE (Q04750) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 767 Score = 31.6 bits (70), Expect = 1.9 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR--SSRDRAGYYS 439 +K D+E ++ + +D D +RE+ + +D + +KEK++H+ SS + Sbjct: 26 DKHKDREHRHKEHK-KDKDKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHK 84 Query: 438 SGDKD 424 DK+ Sbjct: 85 DRDKE 89
>NCOR1_XENTR (Q4KKX4) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2494 Score = 31.2 bits (69), Expect = 2.5 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYY 442 R R+ D ER+R+R K R R++ D+E+ R R + + +Y Sbjct: 1777 RERERDRERDREREKEQRERER-----DRERERERLAAAPSDHY 1815
>U2AF2_DROME (Q24562) Splicing factor U2AF 50 kDa subunit (U2 auxiliary factor| 50 kDa subunit) (U2 snRNP auxiliary factor large subunit) Length = 416 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSD 490 ++E D+E R RD ER RDR SR K S Y D Sbjct: 5 DRERDRERRRHRSRSRDRHRERSRDRRHHRNSRRKPSLYWD 45 Score = 29.6 bits (65), Expect = 7.2 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 558 DHERERDRAKRHRSRDKSSGYS-DKEKSRHRSSRDRAGYY 442 D ER+R+R +RHRSR + +++ HR+SR + Y Sbjct: 5 DRERDRER-RRHRSRSRDRHRERSRDRRHHRNSRRKPSLY 43
>RSRC1_MOUSE (Q9DBU6) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 R RD D + RD+ KR + +DK K+K H R +G +G Sbjct: 132 RSRDRDRRKVRDKEKREKEKDKG-----KDKEVHSIKRGDSGNIKAG 173
>RSRC1_HUMAN (Q96IZ7) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 31.2 bits (69), Expect = 2.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 R RD + + RD+ KR + +DK K+K H R +G +G Sbjct: 132 RSRDRERRKGRDKEKREKEKDKG-----KDKELHNIKRGESGNIKAG 173
>SNUT3_HUMAN (Q8WVK2) U4/U6.U5 tri-snRNP-associated protein 3 (U4/U6.U5| tri-snRNP-associated 27 kDa protein) (27K) (Nucleic acid-binding protein RY-1) Length = 155 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R R + ERER R +R RSR++ D+ +SR RS R Sbjct: 15 RSRSTSRERERRRRERSRSRER-----DRRRSRSRSPHRR 49
>SFR17_HUMAN (Q8TF01) Splicing factor, arginine/serine-rich 130| (Serine-arginine-rich splicing regulatory protein 130) (SRrp130) (SR-rich protein) (SR-related protein) Length = 805 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRD----KSSGYSDKEKSRHRSSR 460 K+ + D+D + +D + ERE+D+ K + R+ K S D+ K + S R Sbjct: 666 KKERSRSIDKDRKKKDKEREREQDKRKEKQKREEKDFKFSSQDDRLKRKRESER 719
>YP62_CAEEL (Q09437) Putative serine/threonine-protein kinase B0495.2 (EC| 2.7.11.1) Length = 719 Score = 31.2 bits (69), Expect = 2.5 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYS--DKEKSRHRSSR 460 E D +R R R S ER+ ++ KRH R K S + D +KS H+ S+ Sbjct: 142 ETDGHRTNRSNRDRSS--ERDSEKHKRHIDRHKKSSTTSPDNDKSPHKKSK 190
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKS---SGYSDKEKSRHRS 466 D+ D R + D+ + RD+ R RSR +S SG S K K R+ S Sbjct: 77 DRGRNDFSYRKKGKDYNKRRDKRSRSRSRHRSPKRSGSSKKSKRRNSS 124
>SNUT3_BRARE (Q6DH74) U4/U6.U5 tri-snRNP-associated protein 3| Length = 158 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R R S +RER R +R RSR + D+ +SR RS R Sbjct: 16 RSRSSSRDRERRRRERERSRSRD---RDRRRSRSRSPHRR 52
>DDX3Y_MOUSE (Q62095) ATP-dependent RNA helicase DDX3Y (EC 3.6.1.-) (DEAD box| protein 3, Y-chromosomal) (DEAD-box RNA helicase DEAD2) (mDEAD2) (D1Pas1-related sequence 1) Length = 658 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 6/66 (9%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDHERERDRAKRH------RSRDKSSGYSDKEKSRHRSSRDRAGYY 442 +DQ+ D++ D+ + +K R+R+ S G DK+ S S+D+ Y Sbjct: 12 LDQQFVGLDLKSSDNQNGGGNTESKGRYIPPHLRNRETSKGVCDKDSSGWSCSKDKDAYS 71 Query: 441 SSGDKD 424 S G +D Sbjct: 72 SFGSRD 77
>TOP1_HUMAN (P11387) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 765 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRS--RDKSSGYSDKEKSRHR--SSRDRAGYYSSGDKD 424 DR+ R ++ E++R+++K S +D + +KEK++H+ SS + DK+ Sbjct: 30 DREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKE 87
>MOG1_CAEEL (P34498) Probable pre-mRNA-splicing factor ATP-dependent RNA| helicase mog-1 (EC 3.6.1.-) (Sex determination protein mog-1) (Masculinization of germ line protein 1) Length = 1131 Score = 31.2 bits (69), Expect = 2.5 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 5/55 (9%) Frame = -1 Query: 609 KEVDQEAXDRDIRG-----RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 ++V ++ DRD RG RD D R+RDR++R R+ SS K++S ++ R Sbjct: 76 EKVHEKHRDRDDRGMKYKSRDDDRRRDRDRSER---REPSSRRGWKDRSGDQTPR 127
>CNG3_CHICK (Q90980) Cyclic nucleotide-gated channel, rod photoreceptor,| subunit alpha (CNG channel 3) (CNG-3) (CNG3) Length = 645 Score = 31.2 bits (69), Expect = 2.5 Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG--YYS 439 EK+ +E + +D + ++ +++ ++H+++DK G ++EK + D AG YY+ Sbjct: 61 EKKKKKEKKSKSENKKDGERQKNKEKKEKHKNKDKKKG-KEEEKKKDIFIIDPAGNMYYN 119
>CACB2_RAT (Q8VGC3) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) Length = 655 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 570 GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 GRD DH + RH+S+D+ Y DKE R AG ++ Sbjct: 608 GRDQDHNECSKQRSRHKSKDR---YCDKEGEVISKRRSEAGEWN 648 Score = 30.0 bits (66), Expect = 5.6 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 11/64 (17%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERE-------RDRAKRHRS----RDKSSGYSDKEKSRHRS 466 +++ E DR + R+ +H E R R RHR+ RD+ K++SRH+ Sbjct: 566 KEDYSHEHVDRYVPHREHNHREESHSSNGHRHREPRHRTRDMGRDQDHNECSKQRSRHK- 624 Query: 465 SRDR 454 S+DR Sbjct: 625 SKDR 628
>CACB2_MOUSE (Q8CC27) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) Length = 655 Score = 30.8 bits (68), Expect = 3.3 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 11/64 (17%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERE-------RDRAKRHRSRDKSSGYSD----KEKSRHRS 466 +++ E DR + R+ +H E R R RHRSRD K++SRH+ Sbjct: 566 KEDYSHEHVDRYVPHREHNHREETHSSNGHRHRESRHRSRDMGRDQDHNECIKQRSRHK- 624 Query: 465 SRDR 454 S+DR Sbjct: 625 SKDR 628 Score = 30.4 bits (67), Expect = 4.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 570 GRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 GRD DH + RH+S+D+ Y DKE R+ AG ++ Sbjct: 608 GRDQDHNECIKQRSRHKSKDR---YCDKEGEVISKRRNEAGEWN 648
>SFR15_RAT (Q63627) Splicing factor, arginine/serine-rich 15 (CTD-binding| SR-like protein RA4) (Fragment) Length = 1048 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -1 Query: 573 RGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSR 460 R R S H R R R++ RH R +S D+EK R R + Sbjct: 367 RSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERERRQK 407
>DDX46_RAT (Q62780) Probable ATP-dependent RNA helicase DDX46 (EC 3.6.1.-)| (DEAD box protein 46) (Helicase of 117.4 kDa) Length = 1032 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDR 454 D++ R RD R RDR + RSR + D+ + R RS SRDR Sbjct: 44 DRDRRRERSRSRDKRRSRSRDRKRLRRSRSRE---RDRSRERRRSRSRDR 90 Score = 29.6 bits (65), Expect = 7.2 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 21/74 (28%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRA--------------KRHRSRDKS-------SGYSDKEKSRHR 469 DR R RD D RER R+ +R RSR++ S D+ +SR R Sbjct: 37 DRRSRSRDRDRRRERSRSRDKRRSRSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSR 96 Query: 468 SSRDRAGYYSSGDK 427 S R+ S G K Sbjct: 97 SRGRRSRSSSPGSK 110
>DDX46_PONPY (Q5R6D8) Probable ATP-dependent RNA helicase DDX46 (EC 3.6.1.-)| (DEAD box protein 46) Length = 1032 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDR 454 D++ R RD R RDR + RSR + D+ + R RS SRDR Sbjct: 44 DRDRRRERSRSRDKRRSRSRDRKRLRRSRSRE---RDRSRERRRSRSRDR 90 Score = 30.0 bits (66), Expect = 5.6 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 21/74 (28%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRA--------------KRHRSRDKS-------SGYSDKEKSRHR 469 DR R RD D RER R+ +R RSR++ S D+ +SR R Sbjct: 37 DRRSRSRDRDRRRERSRSRDKRRSRSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSR 96 Query: 468 SSRDRAGYYSSGDK 427 S R+ S G+K Sbjct: 97 SRGRRSRSSSPGNK 110
>DDX46_MOUSE (Q569Z5) Probable ATP-dependent RNA helicase DDX46 (EC 3.6.1.-)| (DEAD box protein 46) Length = 1032 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDR 454 D++ R RD R RDR + RSR + D+ + R RS SRDR Sbjct: 44 DRDRRRERSRSRDKRRSRSRDRKRLRRSRSRE---RDRSRERRRSRSRDR 90 Score = 29.6 bits (65), Expect = 7.2 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 21/74 (28%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRA--------------KRHRSRDKS-------SGYSDKEKSRHR 469 DR R RD D RER R+ +R RSR++ S D+ +SR R Sbjct: 37 DRRSRSRDRDRRRERSRSRDKRRSRSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSR 96 Query: 468 SSRDRAGYYSSGDK 427 S R+ S G K Sbjct: 97 SRGRRSRSSSPGSK 110
>DDX46_HUMAN (Q7L014) Probable ATP-dependent RNA helicase DDX46 (EC 3.6.1.-)| (DEAD box protein 46) (PRP5 homolog) Length = 1032 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRS-SRDR 454 D++ R RD R RDR + RSR + D+ + R RS SRDR Sbjct: 44 DRDRRRERSRSRDKRRSRSRDRKRLRRSRSRE---RDRSRERRRSRSRDR 90 Score = 30.0 bits (66), Expect = 5.6 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 21/74 (28%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRA--------------KRHRSRDKS-------SGYSDKEKSRHR 469 DR R RD D RER R+ +R RSR++ S D+ +SR R Sbjct: 37 DRRSRSRDRDRRRERSRSRDKRRSRSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSR 96 Query: 468 SSRDRAGYYSSGDK 427 S R+ S G+K Sbjct: 97 SRGRRSRSSSPGNK 110
>PRP5_ASPOR (Q2U2J6) Pre-mRNA-processing ATP-dependent RNA helicase prp5 (EC| 3.6.1.-) Length = 1186 Score = 30.8 bits (68), Expect = 3.3 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 585 DRDIRGRDSDHE-RERDRAKRHRSRDKSSGYSD-KEKSRHRSSRDRA 451 DRD R R D + R R R R+R ++ +D K KSR SR+RA Sbjct: 100 DRDYRRRSRDRDFRSRRDDSRDRARRRTDDSADLKHKSRRDDSRERA 146
>FIP1_BRARE (Q5XJD3) Pre-mRNA 3'-end-processing factor FIP1 (FIP1-like 1)| Length = 570 Score = 30.8 bits (68), Expect = 3.3 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 564 DSDHERERDRAKRHRS-RDKSSGYSDKEKSRHRSSR 460 D +ER R+RA R + R + +KE+ RH+SSR Sbjct: 488 DRGYERHRERASREKEERHGGRRHREKEEGRHKSSR 523
>CD2L5_MOUSE (Q69ZA1) Cell division cycle 2-like protein kinase 5 (EC 2.7.11.22)| (CDC2-related protein kinase 5) Length = 1511 Score = 30.8 bits (68), Expect = 3.3 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRSRD--KSSGYSDKEKSRH-RSSRDRAGYYSSG 433 R R R S R ++R + HR RD +S + K +SRH S +RA SG Sbjct: 197 RPRRDRRSSSGRSKERHREHRRRDGTRSGSEASKARSRHGHSGEERAEAAKSG 249
>U2AF2_MOUSE (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) Length = 475 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 +++ D++ R R H R R R ++ RSR + D ++S R R R+ + G K+ Sbjct: 14 NKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRD-QRSASRDRRRRSKPLTRGAKE 71 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 561 SDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 +++++ERD+ RHR R S S K R R SRDR Sbjct: 12 NENKQERDKENRHRKRSHSRSRSRDRKRRSR-SRDR 46
>U2AF2_HUMAN (P26368) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor| 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) (hU2AF(65)) Length = 475 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 +++ D++ R R H R R R ++ RSR + D ++S R R R+ + G K+ Sbjct: 14 NKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRD-QRSASRDRRRRSKPLTRGAKE 71 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 561 SDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 +++++ERD+ RHR R S S K R R SRDR Sbjct: 12 NENKQERDKENRHRKRSHSRSRSRDRKRRSR-SRDR 46
>ZO2_HUMAN (Q9UDY2) Tight junction protein ZO-2 (Zonula occludens 2 protein)| (Zona occludens 2 protein) (Tight junction protein 2) Length = 1190 Score = 30.8 bits (68), Expect = 3.3 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 18/54 (33%) Frame = -1 Query: 573 RGRDSDHERERDRAK---------------RHRSRDKSSGYS---DKEKSRHRS 466 RG D DH R RDR++ R R RD+S G S D E++ HR+ Sbjct: 203 RGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRA 256
>TOP1_RAT (Q9WUL0) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 767 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR--SSRDRAGYYS 439 +K D+E ++ + +D D +RE+ + +D + +KEK++H+ SS + Sbjct: 26 DKHKDREHRHKEHK-KDKDKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSDKHKDKHK 84 Query: 438 SGDKD 424 DK+ Sbjct: 85 DRDKE 89
>TOP1_CRIGR (Q07050) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 767 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRS----RDKSSGYSDKEKSRHR--SSRDRAGYYSSGDKD 424 DR+ R ++ ++E+DR K S +D + +KEK++H+ SS + DK+ Sbjct: 30 DREHRHKEHKKDKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKE 89
>TOP1_CERAE (Q7YR26) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 767 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRS----RDKSSGYSDKEKSRHR--SSRDRAGYYSSGDKD 424 DR+ R ++ ++E+DR K S +D + +KEK++H+ SS + DK+ Sbjct: 30 DREHRHKEHKKDKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKE 89
>SFR15_HUMAN (O95104) Splicing factor, arginine/serine-rich 15 (CTD-binding| SR-like protein RA4) Length = 1147 Score = 30.8 bits (68), Expect = 3.3 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = -1 Query: 600 DQEAXDRDIRG---RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 D++ +RD R R D +R RD +R+R +SSG+ D+E R SRDR Sbjct: 1022 DRDNSNRDRREWGRRSPDRDRHRDLEERNR---RSSGHRDRE----RDSRDR 1066 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -1 Query: 573 RGRDSDHERERDRAK---RHRSRDKSSGYSDKEKSRHRSSR 460 R R S H R R R++ RH R +S D+EK R R + Sbjct: 453 RSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERERRQK 493
>BTBDA_PONPY (Q5R585) BTB/POZ domain-containing protein 10| Length = 475 Score = 25.0 bits (53), Expect(2) = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 389 PCCKNIRRESTKVLTEREKDLVSSGVTLPIP 297 PC +N+ + + EREKD SS + P P Sbjct: 85 PCIRNVTSPTRQHHVEREKDHSSSRPSSPRP 115 Score = 24.3 bits (51), Expect(2) = 3.4 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 576 IRGRDSDHERERDRAK-RHRSRDKS 505 + G HER RDR + RSRD S Sbjct: 51 LHGASGGHERSRDRRRSSDRSRDSS 75
>BTBDA_HUMAN (Q9BSF8) BTB/POZ domain-containing protein 10| Length = 475 Score = 25.0 bits (53), Expect(2) = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 389 PCCKNIRRESTKVLTEREKDLVSSGVTLPIP 297 PC +N+ + + EREKD SS + P P Sbjct: 85 PCIRNVTSPTRQHHVEREKDHSSSRPSSPRP 115 Score = 24.3 bits (51), Expect(2) = 3.4 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 576 IRGRDSDHERERDRAK-RHRSRDKS 505 + G HER RDR + RSRD S Sbjct: 51 LHGASGGHERSRDRRRSSDRSRDSS 75
>YL53_CAEEL (P34433) Hypothetical protein F44E2.3| Length = 244 Score = 30.4 bits (67), Expect = 4.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 582 RDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSGDKD 424 R R R +R+R+ KR RD+ D+E+ R R R+R + S + Sbjct: 3 RRSRSRSRSPKRDREERKRREDRDR-----DRERKRDRKDRERKRRHRSSSSE 50 Score = 29.3 bits (64), Expect = 9.5 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 DR+ R R D +R+R+R + + R++ K RHRSS Sbjct: 15 DREERKRREDRDRDRERKRDRKDRER--------KRRHRSS 47
>SPP2_EMENI (Q5B4R9) Pre-mRNA-splicing factor spp2| Length = 523 Score = 30.4 bits (67), Expect = 4.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDS---DHERERDRAKRHRSRDK-SSGYSDKEKSRHRSSRDR 454 ++ D+ DRD R D +R RDR R+ D+ SS YS S + +RDR Sbjct: 453 DRRDDRYYRDRDRERRSDPVRDRDRNRDRKSRYYDDDRNSSWYSSSTASSKQRNRDR 509 Score = 30.4 bits (67), Expect = 4.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 RD DH R+RDR + R + Y + + S RDR+ Sbjct: 396 RDKDHHRDRDRDRDSRRLEYDDTYRYESRRNGSSRRDRS 434
>RBM23_HUMAN (Q86U06) Probable RNA-binding protein 23 (RNA-binding motif protein| 23) (RNA-binding region-containing protein 4) (Splicing factor SF2) Length = 439 Score = 30.4 bits (67), Expect = 4.2 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 DRD R + R R RHRSR + + +SR DR Y S Sbjct: 80 DRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRS 128
>BTBDA_MOUSE (Q80X66) BTB/POZ domain-containing protein 10| Length = 475 Score = 24.6 bits (52), Expect(2) = 4.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 389 PCCKNIRRESTKVLTEREKDLVSSGVTLPIP 297 PC +N+ + + EREKD SS + P P Sbjct: 85 PCIRNVTSPTRQHHIEREKDHSSSRPSSPRP 115 Score = 24.3 bits (51), Expect(2) = 4.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 576 IRGRDSDHERERDRAK-RHRSRDKS 505 + G HER RDR + RSRD S Sbjct: 51 LHGASGGHERSRDRRRSSDRSRDSS 75
>NO40_MACFA (Q95KF9) Nucleolar protein of 40 kDa (pNO40) (Zinc finger CCHC| domain-containing protein 2) (Putative S1 RNA binding domain protein) (PS1D protein) Length = 193 Score = 30.0 bits (66), Expect = 5.6 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR 469 +K D+++ D D SD E + + RH S+D + K+K +H+ Sbjct: 145 KKHRDRKSSDSD----SSDSESDTGKRARHTSKDSKAAKKKKKKKKHK 188
>CWC25_DEBHA (Q6BNE1) Pre-mRNA-splicing factor CWC25| Length = 244 Score = 30.0 bits (66), Expect = 5.6 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -1 Query: 585 DRDIRGRDSDHERERDRAKRHRS---RDKSSGYSDKEKSRHRSSRDRAGYYSSGD 430 DR H+ + D+ +HR R+ SG S K KS HR SRD+ S D Sbjct: 172 DRSPNRHTFRHKSDNDKVSKHRHSSHRESRSGRS-KLKSSHRHSRDKDSIDGSKD 225
>SNUT3_MOUSE (Q8K194) U4/U6.U5 tri-snRNP-associated protein 3| Length = 155 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDR 454 R R + +RER R +R RSR++ D+ +SR RS R Sbjct: 15 RSRSTSRDRERRRRERSRSRER-----DRRRSRSRSPHRR 49
>CVCB_PEA (P13919) Convicilin precursor (Fragment)| Length = 386 Score = 30.0 bits (66), Expect = 5.6 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = -1 Query: 612 EKEVDQEAXDRDIRG---RDSDHERERDRAKRHRS-RDKSSGYSDKEKSRHRSSRDR 454 E+E D+E D + RG R+ ER R R + R+ RD+ +E+ R S++R Sbjct: 143 EREEDEEQVDEEWRGSQRREDPEERARLRHREERTKRDRRHQREGEEEERSSESQER 199
>PPIL4_GIBZE (Q4IE79) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 605 Score = 30.0 bits (66), Expect = 5.6 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -1 Query: 600 DQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRH 472 D+ RD RD D R RDR R R R+K Y E H Sbjct: 441 DRRGDRRDRDRRDQDRNRYRDRDHRDRGREKDR-YGRDENDHH 482
>CCAR1_XENLA (Q641G3) Cell division cycle and apoptosis regulator protein 1| Length = 1157 Score = 30.0 bits (66), Expect = 5.6 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -1 Query: 576 IRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSR 460 I R D RER+R +R RSRD+S +++SR RS R Sbjct: 318 ILSRKDDRNRERERERR-RSRDRS---PQRKRSRERSPR 352
>YP68_CAEEL (Q09217) Hypothetical protein B0495.8| Length = 313 Score = 30.0 bits (66), Expect = 5.6 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -1 Query: 597 QEAXDRDIRGRDSDH---ERERDRAKRHRSRDKSSGYSDKEKSRHRSSRD 457 +E+ R RG D +R+RDR R RSR + Y ++ R RD Sbjct: 253 RESYGRRDRGGDRGEYRGDRDRDRRNRDRSRSRDRSYRRDDRGDRRYDRD 302
>SAFB1_RAT (O88453) Scaffold attachment factor B (Scaffold attachment factor| B1) (SAF-B) Length = 931 Score = 30.0 bits (66), Expect = 5.6 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYY 442 + RDS+ RER+R + R + + + +E+ R +R+R ++ Sbjct: 635 KSRDSESRRERERERSEREQRLQAQWEREERERLEIARERLAFH 678
>NO40_HUMAN (Q9NP64) Nucleolar protein of 40 kDa (pNO40) (Zinc finger CCHC| domain-containing protein 7) (Putative S1 RNA binding domain protein) (PS1D protein) (Pnn-interacting nucleolar protein) Length = 241 Score = 30.0 bits (66), Expect = 5.6 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR 469 +K D+++ D D SD E + + RH S+D + K+K +H+ Sbjct: 193 KKHRDRKSSDSD----SSDSESDTGKRARHTSKDSKAAKKKKKKKKHK 236
>CYP8_CAEEL (P52016) Peptidyl-prolyl cis-trans isomerase 8 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-8) Length = 466 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 597 QEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 +E +D GR+ +R R RH RD+ S + + R+R DR+G Sbjct: 220 REEKKKDKHGREEKRDRRRRSNDRH-GRDRRSRSRSQSRDRNRRRDDRSG 268
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 29.6 bits (65), Expect = 7.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHR 469 R R+ + ERERDR + R++ SD+E+ R R Sbjct: 1769 RERERERERERDREREKEQRERE---SDRERERDR 1800
>XE7_HUMAN (Q02040) B-lymphocyte antigen precursor (B-lymphocyte surface| antigen) (721P) (Protein XE7) Length = 695 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Frame = -1 Query: 573 RGRDSDHERER-----DRAKRHRSRDKSSGYSDKEKSRHRSSRDRA 451 R DH R R DR +R RSR++ G + ++ SRHR +R+ Sbjct: 637 RSTSPDHTRSRRSHSKDRHRRERSRER-RGSASRKHSRHRRRSERS 681
>CAC1B_DISOM (P56698) Probable voltage-dependent N-type calcium channel alpha-1B| subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (DOE-4) Length = 2326 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 609 KEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKS-SGYSDKEKSRHRSSR 460 KE ++E RD +GR + R + +RH S ++E RHRS R Sbjct: 887 KETEKE---RDEKGRKGERSRSHEGGRRHHHAQSSLDDAPEREHRRHRSHR 934
>CCNT_DROME (O96433) Cyclin-T| Length = 1097 Score = 29.6 bits (65), Expect = 7.2 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 561 SDHERERDRAKRHRSRDKSSGYSDK-EKSRHRSSRDRAGYYSSGDKD 424 S+ ++++D+ K H+ +DKS ++K E+ +H+ + + S G KD Sbjct: 870 SEKKKKKDKHK-HKEKDKSKDKTEKEERKKHKKDKQKDRSGSGGSKD 915
>CBX8_HUMAN (Q9HC52) Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3)| (HPC3) (Rectachrome 1) Length = 389 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 10/50 (20%) Frame = -1 Query: 573 RGRDSDHERERDRAK-------RHRSRDKSSGYS---DKEKSRHRSSRDR 454 R RD D +RERDR + R R R++ G S DK S SS+ R Sbjct: 150 RDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKR 199
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 573 RGRDSDHERERDRAK-RHRSRDKSSGYSDKEKSRHRSSR 460 R R+ RER R + R R+RD +SD R RS R Sbjct: 6 RERERSQSRERSRTRERSRTRDSKRDHSDSRSLRRRSYR 44
>SWC5_ASPFU (Q4WRE2) SWR1-complex protein 5| Length = 359 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 606 EVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKE 484 ++D + D D+ G DSD E AKR ++ + D+E Sbjct: 28 QLDPDQEDADLTGSDSDDEATEPAAKRRKTGPTKAATEDQE 68
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 543 RDRAKRHRSRDKSSGYSDKEKSRHRSS-RDRAGYYSSG 433 R+ + R RS S+ + +S RSS R R GYY SG Sbjct: 354 RNASTRRRSSSSSASRTSSSRSSSRSSSRSRRGYYRSG 391
>CCNL1_BRARE (Q7ZVX0) Cyclin-L1| Length = 498 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYS---DKEKSRHRSSRDRAGYY 442 + Q DRD R S+ R ++ +R RSR +S+ D++ +H+ R +G++ Sbjct: 411 ISQLRTDRD---RPSETSRHSNKRRRSRSRSRSNSRERVRDRDHIKHKQERSGSGHH 464
>DDX3X_MOUSE (Q62167) ATP-dependent RNA helicase DDX3X (EC 3.6.1.-) (DEAD box| protein 3, X-chromosomal) (DEAD box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1Pas1-related sequence 2) Length = 661 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDHERERDRAKRH-----RSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 +DQ+ D+ D+ R+ R+R+ + G+ DK+ S SS+D+ Y S Sbjct: 11 LDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSS 70 Query: 438 SGDK 427 G + Sbjct: 71 FGSR 74
>DDX3X_HUMAN (O00571) ATP-dependent RNA helicase DDX3X (EC 3.6.1.-) (DEAD box| protein 3, X-chromosomal) (Helicase-like protein 2) (HLP2) (DEAD box, X isoform) Length = 661 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = -1 Query: 603 VDQEAXDRDIRGRDSDHERERDRAKRH-----RSRDKSSGYSDKEKSRHRSSRDRAGYYS 439 +DQ+ D+ D+ R+ R+R+ + G+ DK+ S SS+D+ Y S Sbjct: 11 LDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSS 70 Query: 438 SGDK 427 G + Sbjct: 71 FGSR 74
>VP40_SCMVC (P16046) Capsid protein P40 [Contains: Assemblin (EC 3.4.21.97)| (Protease); Gene APNG.7 protein; Capsid assembly protein; Gene APNG.5 protein; Gene APNG.4 protein; C-terminal peptide] Length = 589 Score = 29.3 bits (64), Expect = 9.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 564 DSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRD 457 ++DH + R R K H RD ++ SD + R+ R+ Sbjct: 448 EADHGKARKRLKAHHGRDNNNSGSDAKGDRYDDIRE 483
>PRP40_MOUSE (Q9R1C7) Pre-mRNA-processing factor 40 homolog A (Formin-binding| protein 3) (Formin-binding protein 11) (FBP 11) Length = 953 Score = 29.3 bits (64), Expect = 9.5 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -1 Query: 564 DSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAG 448 +SD ERE+D+ ++ R +K + +S+H+S + + G Sbjct: 883 ESDTEREKDKKEKDRDSEKDRS-RQRSESKHKSPKKKTG 920
>IF3A_MOUSE (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3| theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a) (p162 protein) (Centrosomin) Length = 1344 Score = 29.3 bits (64), Expect = 9.5 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 567 RDSDHERERDRAKRHRSRDKSSGYSD-KEKSRHRSSRDRAG 448 RDS +RDR R R RD D +++ R RDR G Sbjct: 1221 RDSSRRDDRDREDRRRDRDDRRDLRDLRDRRDLRDDRDRRG 1261
>TRA2_DROME (P19018) Transformer-2 sex-determining protein| Length = 264 Score = 29.3 bits (64), Expect = 9.5 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = -1 Query: 573 RGRDSDHE-----RERDRAKRHRSRDKSSGYSDKEKSRH---RSSRDRAGYYSS 436 + R SD++ R + + R RSR +SS S + RH RSSRDR + S Sbjct: 36 KDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKS 89
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 29.3 bits (64), Expect = 9.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 + +D D E++RDR R R RDK + E +R R S Sbjct: 5 KDKDKDKEKDRDR-DRDRERDKRDKARESENARPRRS 40
>CTDP1_HUMAN (Q9Y5B0) RNA polymerase II subunit A C-terminal domain phosphatase| (EC 3.1.3.16) (TFIIF-associating CTD phosphatase) Length = 961 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 32 LQQYXMHISLGSCNQNNTK-VFHVPPGHKKPGYHAVTITHCQKPFMSKVA 178 L Q +H + C Q + K +FH G +P H HC K F+ K+A Sbjct: 189 LDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHC-KDFLEKIA 237
>DNMT1_HUMAN (P26358) DNA (cytosine-5)-methyltransferase 1 (EC 2.1.1.37) (Dnmt1)| (DNA methyltransferase HsaI) (DNA MTase HsaI) (MCMT) (M.HsaI) Length = 1616 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -1 Query: 594 EAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRD-RAGYYSSGDKD 424 E +R G ++ E ERD + R R ++ + K+K + R+ RAG + D+D Sbjct: 220 EEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDED 277
>IF3A_HUMAN (Q14152) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3| theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a) Length = 1382 Score = 29.3 bits (64), Expect = 9.5 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -1 Query: 612 EKEVDQEAXDRDIRGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSSRDRAGYYSSG 433 EKE D++ DR+ D D ERERDR + D+ D+ R + + + + S Sbjct: 1206 EKERDRDNQDRE--ENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSS 1263 Query: 432 DKD 424 +D Sbjct: 1264 RRD 1266
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 29.3 bits (64), Expect = 9.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 573 RGRDSDHERERDRAKRHRSRDKSSGYSDKEKSRHRSS 463 + +D D E++RDR R R RDK + E +R R S Sbjct: 5 KDKDKDKEKDRDR-DRDRERDKRDKARESENARPRRS 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,259,306 Number of Sequences: 219361 Number of extensions: 1592262 Number of successful extensions: 6561 Number of sequences better than 10.0: 170 Number of HSP's better than 10.0 without gapping: 5032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6122 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)