Clone Name | rbasd23m02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TNR5_HUMAN (P25942) Tumor necrosis factor receptor superfamily m... | 34 | 0.26 |
---|
>TNR5_HUMAN (P25942) Tumor necrosis factor receptor superfamily member 5| precursor (CD40L receptor) (B-cell surface antigen CD40) (CDw40) (Bp50) Length = 277 Score = 33.9 bits (76), Expect = 0.26 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 317 HPSQR*AIR--QYHLNRNLCDLIXLGEMKHTDCSRFAERHCVLCPQIKLIEPLER 475 HP A R QY +N C L G+ +DC+ F E C+ C + + ++ R Sbjct: 19 HPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNR 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,340,758 Number of Sequences: 219361 Number of extensions: 704319 Number of successful extensions: 1676 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1676 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)