Clone Name | rbasd24b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZSWM6_MOUSE (Q80TB7) Zinc finger SWIM domain-containing protein ... | 32 | 1.3 | 2 | RPOC_PSEHT (Q3ILP8) DNA-directed RNA polymerase beta' chain (EC ... | 30 | 5.0 |
---|
>ZSWM6_MOUSE (Q80TB7) Zinc finger SWIM domain-containing protein 6 (Fragment)| Length = 1017 Score = 31.6 bits (70), Expect = 1.3 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +3 Query: 162 NCTNRACFHLSPVILFSVHTELTGKELGIDMPLPLFTDLDINILQVNTKQILGFEHWL-T 338 +C N+ F+ + V+ S++ +++ + +P+ + Q+N Q+ F +L T Sbjct: 65 SCGNKDIFYCAHVVALSLYRIRKPEQVKLHLPI------SETLFQMNRDQLQKFVQYLIT 118 Query: 339 VHHTEII 359 VHHTE++ Sbjct: 119 VHHTEVL 125
>RPOC_PSEHT (Q3ILP8) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1390 Score = 29.6 bits (65), Expect = 5.0 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +3 Query: 186 HLSPVILFSVHTELTGKELGIDMPLPLFTDLDINILQVNTKQIL 317 HL P++ + + + G ++ + +PL + L+ L ++T IL Sbjct: 448 HLHPLVCAAYNADFDGDQMAVHVPLTIEAQLEARALMMSTNNIL 491 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,963,796 Number of Sequences: 219361 Number of extensions: 1601197 Number of successful extensions: 3820 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3818 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)