Clone Name | rbasd23l20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LFC_TACTR (P28175) Limulus clotting factor C precursor (EC 3.4.2... | 28 | 4.6 |
---|
>LFC_TACTR (P28175) Limulus clotting factor C precursor (EC 3.4.21.84) (FC)| [Contains: Limulus clotting factor C heavy chain; Limulus clotting factor C light chain; Limulus clotting factor C chain A; Limulus clotting factor C chain B] Length = 1019 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 159 RQCNRLGVTKHSCINIPSSCLIYSGLL*FSC*NP 260 R+C ++ +H +N PS +I L FSC +P Sbjct: 197 RECAKVSSPEHGKVNAPSGNMIEGATLRFSCDSP 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,944,528 Number of Sequences: 219361 Number of extensions: 388415 Number of successful extensions: 714 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)