| Clone Name | rbasd23l14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4 | 52 | 1e-06 | 2 | TRP_DROME (P19334) Transient receptor potential protein | 31 | 1.5 | 3 | CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC... | 30 | 2.6 | 4 | DNAA_MYCSM (P49992) Chromosomal replication initiator protein dnaA | 29 | 7.6 |
|---|
>RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4| Length = 211 Score = 51.6 bits (122), Expect = 1e-06 Identities = 21/39 (53%), Positives = 29/39 (74%) Frame = -3 Query: 352 SEESGRPLPKFGEWDVNDPASXDGFTVIFNKARDEKKAG 236 S E +PKFG+WD N+P+S DG+T IFNK R+E+ +G Sbjct: 141 SPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSG 179
>TRP_DROME (P19334) Transient receptor potential protein| Length = 1275 Score = 31.2 bits (69), Expect = 1.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 310 DVNDPASXDGFTVIFNKARDEKKAGNGQDTESPCKDAR 197 +V++ + DG K D+KKAG+ +D + P KD++ Sbjct: 985 NVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKDSK 1022
>CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 367 Score = 30.4 bits (67), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 185 HPLSPGVFARGFSILSIPSLFLIPGFVEYNCESI 286 H + G++ RGFSI+ +P F +EYN + I Sbjct: 192 HGILYGLYKRGFSIVRVPCSFSASKIIEYNPKGI 225
>DNAA_MYCSM (P49992) Chromosomal replication initiator protein dnaA| Length = 504 Score = 28.9 bits (63), Expect = 7.6 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 191 LSPGVFARGFSILSIPSLFLIPGFVEYNCESIXRSWVVDVPFAKLGQR 334 + P V A GF++LS+P+ FV+ E R +V KLGQR Sbjct: 48 VKPLVIAEGFALLSVPT-----PFVQNEIERHLREPIVTALSRKLGQR 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,552,184 Number of Sequences: 219361 Number of extensions: 1283997 Number of successful extensions: 3129 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3129 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)