ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd23k09 |
|---|---|
| Clone Library Name | barley_pub |
>STAG3_RAT (Q99M76) Cohesin subunit SA-3 (Stromal antigen 3) (Stromalin 3)| (SCC3 homolog 3) Length = 1256 Score = 32.0 bits (71), Expect = 1.6 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 470 LLHQKGRRLMSSCRLKKPGWLELDARPDILLRY 372 LLHQ+ R L C+L G LELDA D+ Y Sbjct: 880 LLHQRRRLLAGFCKLLLYGVLELDAASDVFKHY 912
>STAG3_MOUSE (O70576) Cohesin subunit SA-3 (Stromal antigen 3) (Stromalin 3)| (SCC3 homolog 3) Length = 1240 Score = 32.0 bits (71), Expect = 1.6 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 470 LLHQKGRRLMSSCRLKKPGWLELDARPDILLRY 372 LLHQ+ R L C+L G LELDA D+ Y Sbjct: 880 LLHQRRRLLAGFCKLLLYGVLELDAASDVFKHY 912
>PDZK3_RAT (Q9QZR8) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Plakophilin-related armadillo repeat protein-interacting PDZ protein) Length = 2766 Score = 27.3 bits (59), Expect(2) = 2.0 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +1 Query: 55 LASSPPAPTDRGEGSRNWPKTYVHPFSPIYLRRAPEQQRKQTSSRGLGCP 204 L+ PP P G PK + R ++ R+ SS GLG P Sbjct: 749 LSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESREANSSPGLGTP 798 Score = 22.7 bits (47), Expect(2) = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 263 SSIVVAGGILEDHPG 307 S VVAG EDHPG Sbjct: 829 SDFVVAGSEDEDHPG 843
>TEP1_MOUSE (P97499) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 homolog) Length = 2629 Score = 30.4 bits (67), Expect = 4.8 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 583 ATHAWGQVIVTASWDGHIRSFQNYGLPV 500 A H GQV+ T SW G I FQ GL V Sbjct: 1814 AFHPEGQVVATGSWAGSITFFQADGLKV 1841
>TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 telomerase homolog) Length = 2627 Score = 30.4 bits (67), Expect = 4.8 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 583 ATHAWGQVIVTASWDGHIRSFQNYGLPV 500 A H GQVI T SW G I FQ GL V Sbjct: 1807 AFHPEGQVIATGSWAGSISFFQVDGLKV 1834
>YMH7_CAEEL (P34474) Hypothetical protein F58A4.7 in chromosome III| Length = 431 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 58 ASSPPAPTDRGEGSRNWPKTYVHPFSPIYLRRAPEQQ 168 ASSP P G G P +Y P LR +PE++ Sbjct: 232 ASSPVTPRSNGSGGFTLPSSYASSALPTPLRESPERK 268
>CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel alpha-1C subunit| (Voltage-gated calcium channel alpha subunit Cav1.2) (Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle) (Smooth muscle calcium channel blocker receptor) Length = 2171 Score = 30.0 bits (66), Expect = 6.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 575 CLGPGHSHRKLGWPHQVIPELRLTGASLTWRLLS--PLLH 462 C P + GWP Q IP LRL GA + +L S P +H Sbjct: 1982 CATPPATPGSRGWPPQPIPTLRLEGADSSEKLNSSFPSIH 2021
>STAG3_HUMAN (Q9UJ98) Cohesin subunit SA-3 (Stromal antigen 3) (Stromalin 3)| (SCC3 homolog 3) Length = 1225 Score = 30.0 bits (66), Expect = 6.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 467 LHQKGRRLMSSCRLKKPGWLELDARPDILLRYKASHHMAG 348 LHQ+ R L C+L G LE+DA D+ Y ++ G Sbjct: 867 LHQRRRLLAGFCKLLLYGVLEMDAASDVFKHYNKFYNDYG 906
>DCMA_METS1 (P43387) Dichloromethane dehalogenase (EC 4.5.1.3) (DCM| dehalogenase) Length = 266 Score = 29.6 bits (65), Expect = 8.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 601 ASCQNAATHAWGQVIVTASWDGH 533 A+CQ+ +H G++I T+ WD H Sbjct: 171 ATCQDLVSHDAGRIIPTSMWDSH 193
>GCP4_ARATH (Q9M350) Gamma-tubulin complex component 4 homolog| Length = 745 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 586 AATHAWGQVIVTASWDGHIRSFQNYGL 506 AA+H W V+V A +GH+++ ++Y L Sbjct: 387 AASHLWQLVVVRADLNGHLKALKDYFL 413
>DAPA_CHLMU (Q9PK33) Dihydrodipicolinate synthase (EC 4.2.1.52) (DHDPS)| Length = 286 Score = 29.6 bits (65), Expect = 8.1 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -3 Query: 521 PELRLTGASLTWRLLSPLLHQKGRRLMSSCR-----LKKPGWLELDARP 390 PE+RL+GAS +LS + + R ++ CR K WLEL P Sbjct: 185 PEMRLSGASGLVSVLSNVWPELARDYVAQCRSIDAWKKTCSWLELSVNP 233
>GCP4_MEDTR (Q9SC88) Gamma-tubulin complex component 4 homolog| Length = 739 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 586 AATHAWGQVIVTASWDGHIRSFQNYGL 506 AA+H W V+V A +GH+++ ++Y L Sbjct: 370 AASHLWQLVVVRADLNGHLKALKDYFL 396
>PDZK3_HUMAN (O15018) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Activated in prostate cancer protein) Length = 2839 Score = 26.2 bits (56), Expect(2) = 8.7 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 Query: 55 LASSPPAPTDRGEGSRNWPKTYVHPFSPIYLRRAPEQQRKQTSSRGLGCP 204 L+ PP P G PK + R ++ ++ SS GLG P Sbjct: 798 LSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANSSPGLGTP 847 Score = 21.6 bits (44), Expect(2) = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 263 SSIVVAGGILEDHPG 307 S +VAG EDHPG Sbjct: 878 SDFMVAGSEDEDHPG 892 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,442,877 Number of Sequences: 219361 Number of extensions: 2329580 Number of successful extensions: 6457 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 6156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6456 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
