Clone Name | rbasd23k08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GUAA_BACCR (Q81IS3) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 28 | 4.3 |
---|
>GUAA_BACCR (Q81IS3) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 515 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = -1 Query: 351 GKKVVPQQMSIKCNTADYRKNNKHVASIVDASCCTSESSPSDVIWFQCKHMIRGLP 184 G +++ QQ K A++R+ K V + + S + V+W ++ GLP Sbjct: 89 GMQLMTQQFGGKVERANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLP 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,850,146 Number of Sequences: 219361 Number of extensions: 909358 Number of successful extensions: 1822 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1822 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)