| Clone Name | rbasd23j10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSZ2_PYRHO (O58491) Cell division protein ftsZ homolog 2 | 32 | 0.39 | 2 | K0690_HUMAN (Q5JTH9) Protein KIAA0690 | 29 | 3.3 | 3 | HPR1_YEAST (P17629) Protein HPR1 | 29 | 3.3 | 4 | RECO_PASMU (P57974) DNA repair protein recO (Recombination prote... | 28 | 4.3 | 5 | BT1_MAIZE (P29518) Protein brittle-1, chloroplast precursor | 28 | 4.3 | 6 | VGLH_HHV6U (P68324) Glycoprotein H precursor | 28 | 4.3 | 7 | VGLH_HHV6G (P68323) Glycoprotein H precursor | 28 | 4.3 | 8 | EXO1_SCHPO (P53695) Exodeoxyribonuclease 1 (EC 3.1.-.-) (Exodeox... | 28 | 5.7 |
|---|
>FTSZ2_PYRHO (O58491) Cell division protein ftsZ homolog 2| Length = 414 Score = 32.0 bits (71), Expect = 0.39 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 22 ARLLXPHTNYMHLHQQLIHKYVPMVSS-AHGEHDHGDRSIQYLCTKSSTDEV 174 A L+ +T+ HLHQ HK + + S HG+ GD I Y ++S E+ Sbjct: 60 ADLIAMNTDAQHLHQIKAHKKLLLGKSITHGKGSGGDPRIGYRAAEASASEI 111
>K0690_HUMAN (Q5JTH9) Protein KIAA0690| Length = 1297 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 134 RSSIYAPKAPPMKCLRPPHRRLSSSEAEFLLAKLEHVLL 250 RS+ K P +KCL R+LS+ EF+ A + V+L Sbjct: 826 RSTSSPAKRPRLKCLLHIVRKLSAEHKEFITALIPEVIL 864
>HPR1_YEAST (P17629) Protein HPR1| Length = 752 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -3 Query: 328 EADLISTKKALYEALMRQDELLAFIDKQDML 236 E++LIS K+ LYE L +++LA ++ D+L Sbjct: 164 ESNLISYKQPLYEKLRHWNDILAKLENNDIL 194
>RECO_PASMU (P57974) DNA repair protein recO (Recombination protein O)| Length = 240 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 4 YTNRYTARLLXPHTNYMHLHQQLIHKYVPMVSSAH 108 Y N R+L P T Y HL Q + + S+ H Sbjct: 95 YVNELLCRVLEPETGYPHLFQDYLRCLTGLASAEH 129
>BT1_MAIZE (P29518) Protein brittle-1, chloroplast precursor| Length = 436 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 116 MIMATDRSSIYAPKAPPMKCLRPPHRRLSSSEAE 217 ++ A D I A APP RPP RR SE E Sbjct: 72 VVRAADNCDIAASLAPPFPGSRPPGRRGRGSEEE 105
>VGLH_HHV6U (P68324) Glycoprotein H precursor| Length = 694 Score = 28.5 bits (62), Expect = 4.3 Identities = 24/90 (26%), Positives = 41/90 (45%) Frame = +2 Query: 41 TQITCIYTNNLYINMYQWLALRTESMIMATDRSSIYAPKAPPMKCLRPPHRRLSSSEAEF 220 T + Y +N+ I+ Y+W + A +IY K + + S E F Sbjct: 375 TYLATAYESNVTISKYKWTDI-------ANTLQNIYE------KHMFFTNLTFSDRETLF 421 Query: 221 LLAKLEHVLLVDEREQLILTH*RLVEGLLC 310 +LA++ +++ DER Q H +L+ G LC Sbjct: 422 MLAEIANIIPTDERMQ---RHMQLLIGNLC 448
>VGLH_HHV6G (P68323) Glycoprotein H precursor| Length = 694 Score = 28.5 bits (62), Expect = 4.3 Identities = 24/90 (26%), Positives = 41/90 (45%) Frame = +2 Query: 41 TQITCIYTNNLYINMYQWLALRTESMIMATDRSSIYAPKAPPMKCLRPPHRRLSSSEAEF 220 T + Y +N+ I+ Y+W + A +IY K + + S E F Sbjct: 375 TYLATAYESNVTISKYKWTDI-------ANTLQNIYE------KHMFFTNLTFSDRETLF 421 Query: 221 LLAKLEHVLLVDEREQLILTH*RLVEGLLC 310 +LA++ +++ DER Q H +L+ G LC Sbjct: 422 MLAEIANIIPTDERMQ---RHMQLLIGNLC 448
>EXO1_SCHPO (P53695) Exodeoxyribonuclease 1 (EC 3.1.-.-) (Exodeoxyribonuclease| I) (Exonuclease I) (EXO I) Length = 571 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +2 Query: 122 MATDRSSIYAPKAPPMKCLRPPHRRLSSSEAEFLLAKLEHVLLVDERE 265 +A +Y PK + L PP R LS E F+ + ++ L +D E Sbjct: 276 LAFRHQRVYCPKDKTLVHLSPPERELSVHEDAFIGSFFDNQLAIDIAE 323 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,101,637 Number of Sequences: 219361 Number of extensions: 769482 Number of successful extensions: 2176 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2175 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)