ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd23i11 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESGKA 10 YPD Y RI GF NMRQVQCVSFIAFKPP C ESGKA Sbjct: 139 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESGKA 10 YPD Y RI GF NMRQVQCVSFIAFKPP C ESGKA Sbjct: 78 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESGKA 10 YPD Y R+ GF NMRQVQCVSFIAF+PP C ESGKA Sbjct: 140 YPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 64.3 bits (155), Expect = 9e-11 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESGKA 10 YPD Y R+ GF N+RQVQCVSFIAF+PP C ESGKA Sbjct: 139 YPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 58.9 bits (141), Expect = 4e-09 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESGKA 10 YPD Y RI GF NMRQVQ VSFIA KPP C ESGKA Sbjct: 140 YPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESG 16 YPD + RI GF N+RQVQ +SFIA+KPP C ESG Sbjct: 140 YPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESG 16 YPD + RI GF N+RQVQ +SFIA+KPP C ESG Sbjct: 140 YPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 49.3 bits (116), Expect = 3e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 +PD Y RI GF N+RQVQC+SF+A+KPP Sbjct: 153 HPDGYARIIGFDNVRQVQCISFLAYKPP 180
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP + RI GF N RQVQCVSFIAFKPP Sbjct: 151 YPSAFIRIIGFDNKRQVQCVSFIAFKPP 178
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 48.5 bits (114), Expect = 5e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 149 YPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP + RI GF N RQVQC+SFIA+KPP E+ Sbjct: 149 YPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP + RI GF N RQVQC+SFIA+KPP E+ Sbjct: 149 YPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 48.1 bits (113), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 48.1 bits (113), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 48.1 bits (113), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 149 YPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 48.1 bits (113), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 151 YPNAWIRIIGFDNVRQVQCISFIAYKPP 178
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 48.1 bits (113), Expect = 7e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N+RQVQC+SFIA+KPP Sbjct: 151 YPNAWIRIIGFDNVRQVQCISFIAYKPP 178
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 47.8 bits (112), Expect = 9e-06 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N RQVQC+SFIA+KPP Sbjct: 149 YPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 47.8 bits (112), Expect = 9e-06 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YPD + R+ GF N++Q QCVSFIA+KPP Sbjct: 140 YPDAFHRVIGFDNIKQTQCVSFIAYKPP 167
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 47.8 bits (112), Expect = 9e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD Y RI GF N+RQVQC+SF+A+KP Sbjct: 153 YPDCYGRIIGFDNVRQVQCISFLAYKP 179
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 47.8 bits (112), Expect = 9e-06 Identities = 19/33 (57%), Positives = 25/33 (75%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP+ + RI GF N RQVQC+SFIA+KPP ++ Sbjct: 50 YPNAFIRIIGFDNNRQVQCISFIAYKPPSFTDA 82
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 47.4 bits (111), Expect = 1e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 47.4 bits (111), Expect = 1e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD + R+ GF N+RQVQC+SFIA+KP Sbjct: 153 YPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 47.4 bits (111), Expect = 1e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N RQVQC+SFIA+KPP Sbjct: 149 YPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 47.4 bits (111), Expect = 1e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + RI GF N RQVQC+SFIA+KPP Sbjct: 149 YPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 47.4 bits (111), Expect = 1e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP + RI GF N RQVQC+SFIA+KPP ++ Sbjct: 149 YPGAFIRIIGFDNTRQVQCISFIAYKPPSFTDA 181
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 46.6 bits (109), Expect = 2e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQC+SFIA+KP Sbjct: 149 YPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQCVSFIA+KP Sbjct: 155 YPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP + RI GF N RQVQC+SFIA+KPP Sbjct: 153 YPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQCVSFIA+KP Sbjct: 151 YPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQCVSFIA+KP Sbjct: 152 YPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 46.2 bits (108), Expect = 3e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 46.2 bits (108), Expect = 3e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP+ RI GF N RQVQC+SFIA+KPP ++ Sbjct: 149 YPNALIRIIGFDNNRQVQCISFIAYKPPSFTDA 181
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 46.2 bits (108), Expect = 3e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 45.8 bits (107), Expect = 3e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQC+SFIA+KP Sbjct: 153 YPNAFIRIIGFDNVRQVQCISFIAYKP 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 45.8 bits (107), Expect = 3e-05 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXESG 16 YPD + RI GF N+RQVQ +SFIA+ P C ESG Sbjct: 138 YPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 154 YPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 154 YPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 45.1 bits (105), Expect = 6e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N RQVQCVSFIA+KP Sbjct: 153 YPSAFIRIIGFDNKRQVQCVSFIAYKP 179
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 150 YPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPQAWVRIIGFDNVRQVQCISFIAYKP 178
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 152 YPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N RQVQC+SFIA+KP Sbjct: 146 YPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.1 bits (105), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA+KP Sbjct: 151 YPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 44.7 bits (104), Expect = 7e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N RQVQCVSFIA+KP Sbjct: 154 YPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 44.7 bits (104), Expect = 7e-05 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP+ + R+ GF N+RQVQC+SFI KPP Sbjct: 151 YPNAFIRVIGFDNIRQVQCISFIVAKPP 178
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 44.3 bits (103), Expect = 1e-04 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD + RI GF N RQVQC+SF+ +KP Sbjct: 149 YPDYFNRIIGFDNTRQVQCISFLTYKP 175
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N RQVQC+SFIA+KP Sbjct: 151 YPHAFIRIIGFDNNRQVQCISFIAYKP 177
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YPD + RI GF N+RQVQC+SFIA P Sbjct: 151 YPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 43.5 bits (101), Expect = 2e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQCVSFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCVSFIASKP 170
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 43.5 bits (101), Expect = 2e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPP 34 YP + RI GF N RQVQ +SFIA+KPP Sbjct: 153 YPSAFIRIIGFDNKRQVQIISFIAYKPP 180
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF + RQVQCVSFIA+KP Sbjct: 151 YPNAFIRIIGFDSNRQVQCVSFIAYKP 177
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 149 YPQAWIRIIGFDNVRQVQCISFIASKP 175
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 149 YPQAWIRIIGFDNVRQVQCISFIASKP 175
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA KP Sbjct: 144 YPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 42.4 bits (98), Expect = 4e-04 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + R+ GF N+RQVQC+SFI KP Sbjct: 160 YPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 42.0 bits (97), Expect = 5e-04 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + R+ GF N+RQVQC+SFIA P Sbjct: 107 YPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 42.0 bits (97), Expect = 5e-04 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ + RI GF N+RQVQC+SFIA P Sbjct: 149 YPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 41.6 bits (96), Expect = 6e-04 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + R+ GF N+RQVQC+SFI KP Sbjct: 144 YPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + R+ GF N+RQVQCVSFI KP Sbjct: 152 YPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + R+ GF N+RQVQCVSFI KP Sbjct: 152 YPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + R+ GF N+RQVQCVSFI KP Sbjct: 152 YPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + RI GF N+RQVQC+ FIA +P Sbjct: 149 YPQAWIRIIGFDNVRQVQCIMFIASRP 175
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 114 PDXYXRIXGFXNMRQVQCVSFIAFKP 37 PD + R GF + R+VQC+SFIA+KP Sbjct: 95 PDAFVRFIGFNDKREVQCISFIAYKP 120
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP + R+ GF N+RQVQCVSFI +P Sbjct: 152 YPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 37.0 bits (84), Expect = 0.015 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 Y D Y R+ GF N++Q Q VSFI +KP Sbjct: 80 YSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 36.6 bits (83), Expect = 0.020 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ Y R+ GF N++Q Q VSFI KP Sbjct: 80 YPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 35.0 bits (79), Expect = 0.058 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP Y R+ GF N++Q Q +SFI KP Sbjct: 80 YPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 34.3 bits (77), Expect = 0.099 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 Y D Y R+ GF N++Q Q VSFI +P Sbjct: 81 YGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 33.1 bits (74), Expect = 0.22 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 105 YXRIXGFXNMRQVQCVSFIAFKP 37 Y R GF N RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 32.3 bits (72), Expect = 0.38 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 +P+ Y R+ F ++RQVQ + F+ +KP Sbjct: 79 FPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 1096 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 808 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 665 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 521 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 378 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 31.6 bits (70), Expect = 0.64 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXES 19 YP Y R+ F +++QVQ +SF+ +P S Sbjct: 234 YPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 31.2 bits (69), Expect = 0.84 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP Y R+ F +++QVQ +SF+ +P Sbjct: 1240 YPQCYVRLAAFDSVKQVQVISFVVQRP 1266
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 31.2 bits (69), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 +PD Y R+ F N +QVQ + F+ +P Sbjct: 145 FPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 31.2 bits (69), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 +PD Y R+ F N +QVQ + F+ +P Sbjct: 145 FPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 46 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 86 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 133 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 144 FPDAYIRLVCFDANRQVQISGFLVHRPPTATD 175
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKPPXCXE 22 +PD Y R+ F RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 30.0 bits (66), Expect = 1.9 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 117 YPDXYXRIXGFXNMRQVQCVSFIAFKP 37 YP+ I GF N+RQ Q ++FIA+KP Sbjct: 139 YPELRA-ILGFDNIRQTQWLTFIAYKP 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.131 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,198,643 Number of Sequences: 219361 Number of extensions: 61648 Number of successful extensions: 170 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
