| Clone Name | rbasd23e24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GPA2_KLULA (P54111) Guanine nucleotide-binding protein alpha-2 s... | 30 | 5.4 | 2 | SCNAA_XENLA (P51167) Amiloride-sensitive sodium channel alpha-su... | 30 | 7.0 | 3 | CO3A1_HUMAN (P02461) Collagen alpha-1(III) chain precursor | 29 | 9.2 |
|---|
>GPA2_KLULA (P54111) Guanine nucleotide-binding protein alpha-2 subunit| (GP2-alpha) Length = 554 Score = 30.0 bits (66), Expect = 5.4 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 596 PGRNNRNRKVTVPNGVNGEKQQDAINGKPKSPVANGVN 483 PG N+ NR+ V G G+K+QD N K K + N + Sbjct: 23 PGANDANRRNDVRKGA-GDKKQDKKNKKAKGSIVNAAS 59
>SCNAA_XENLA (P51167) Amiloride-sensitive sodium channel alpha-subunit| (Epithelial Na+ channel alpha subunit) (Alpha ENaC) (Nonvoltage-gated sodium channel 1 alpha subunit) (SCNEA) (Alpha NaCH) Length = 632 Score = 29.6 bits (65), Expect = 7.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 136 MMIVRRQQEKKEELGEPNYLTRFPAPAFGDRSFMNPHV 249 M+++ R KK GE + PAPAF D PH+ Sbjct: 540 MILLHRYYYKKANEGEETTVVPTPAPAFADLEQQVPHI 577
>CO3A1_HUMAN (P02461) Collagen alpha-1(III) chain precursor| Length = 1466 Score = 29.3 bits (64), Expect = 9.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 596 PGRNNRNRKVTVPNGVNGEKQQDAINGKPKSPVANGVNG 480 PG + +P GV G K +D +G P P ANG+ G Sbjct: 443 PGPRGERGEAGIP-GVPGAKGEDGKDGSPGEPGANGLPG 480 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,588,656 Number of Sequences: 219361 Number of extensions: 1270172 Number of successful extensions: 3255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3254 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)