Clone Name | rbasd23c19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YDEM_CAEEL (Q19124) Hypothetical WD-repeat protein F02E8.5 | 28 | 5.4 | 2 | EST3_RAT (Q63108) Liver carboxylesterase 3 precursor (EC 3.1.1.1... | 28 | 7.0 | 3 | Y131_UREPA (Q9PR13) Hypothetical protein UU131 | 28 | 7.0 | 4 | BGLS_KLUMA (P07337) Beta-glucosidase precursor (EC 3.2.1.21) (Ge... | 28 | 7.0 |
---|
>YDEM_CAEEL (Q19124) Hypothetical WD-repeat protein F02E8.5| Length = 578 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 156 WIDCLRPSCFISVLFIT*CFA 218 W C+ PSC V+FI CFA Sbjct: 12 WSRCVHPSCVAWVIFIHFCFA 32
>EST3_RAT (Q63108) Liver carboxylesterase 3 precursor (EC 3.1.1.1)| (Carboxyesterase ES-3) (pI 5.5 esterase) (ES-HTEL) Length = 561 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 11 QKIPFVNCCQKEQWVSIVHCLTKWLEEKLVD 103 +KI V+ C+ S+VHCL + EE+L++ Sbjct: 265 EKIAVVSGCKSTTSASMVHCLRQKTEEELLE 295
>Y131_UREPA (Q9PR13) Hypothetical protein UU131| Length = 268 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 265 SLIMGANNNKGPRAXDAKHYVMKXTLIKHDG 173 SLI N N P+ +A HY I H+G Sbjct: 110 SLINNTNKNNDPKLYEALHYHAHSKFINHNG 140
>BGLS_KLUMA (P07337) Beta-glucosidase precursor (EC 3.2.1.21) (Gentiobiase)| (Cellobiase) (Beta-D-glucoside glucohydrolase) Length = 845 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = -2 Query: 148 QPRKKSSRVLTNNKLIHQLFL*PFS*TVYYAHPLFFLTTINK 23 + ++ SS + + + + +++L PF V +A+P+ +T NK Sbjct: 154 EDQRFSSNSIVSERALREIYLEPFRLAVKHANPVCIMTAYNK 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,779,673 Number of Sequences: 219361 Number of extensions: 731853 Number of successful extensions: 1335 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)