Clone Name | rbasd23c03 |
---|---|
Clone Library Name | barley_pub |
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 30.4 bits (67), Expect = 3.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 414 HRRSAPACCCWNLKDCSMACLSYLC 340 H S P C C N KDC C S C Sbjct: 1357 HTDSGPRCFCLNPKDCESGCASNPC 1381
>Y004_MYCSM (Q50434) UPF0232 protein in recF-gyrB intergenic region| Length = 194 Score = 30.0 bits (66), Expect = 4.8 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 442 SKGFTRTNGMEVARWRCGNCRGCNHFLSRCGREKRRGTWSG 564 ++G R+ G +V R R G R R G +RR TWSG Sbjct: 39 ARGAARSQGKDVGRGRSGPAR-------RVGGNRRRRTWSG 72
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 29.6 bits (65), Expect = 6.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 414 HRRSAPACCCWNLKDCSMACLSYLC 340 H S P C C N KDC C S C Sbjct: 1359 HTASGPHCFCPNHKDCESGCASNPC 1383
>SYTL4_HUMAN (Q96C24) Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin)| Length = 671 Score = 29.6 bits (65), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 487 RCGNCRGCNHFLSR-CGREKRRGTW 558 + CRGCNH + R C ++ GTW Sbjct: 76 KTNTCRGCNHLVCRDCRIQESNGTW 100
>ANGL6_HUMAN (Q8NI99) Angiopoietin-related protein 6 precursor| (Angiopoietin-like 6) (Angiopoietin-related growth factor) (Angiopoietin-related protein 5) Length = 470 Score = 29.6 bits (65), Expect = 6.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 189 LLIMEAIAWA-AGAISCPLSFYLGPDKQKKTLCWA 88 LL++ +WA AGA C +F L P K +CW+ Sbjct: 11 LLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWS 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,001,245 Number of Sequences: 219361 Number of extensions: 1454776 Number of successful extensions: 3452 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3445 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)