Clone Name | rbasd23b15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | METH_HUMAN (Q99707) Methionine synthase (EC 2.1.1.13) (5-methylt... | 31 | 2.1 | 2 | ITCH_MOUSE (Q8C863) Itchy E3 ubiquitin protein ligase (EC 6.3.2.-) | 30 | 3.5 | 3 | ITCH_HUMAN (Q96J02) Itchy homolog E3 ubiquitin protein ligase (E... | 30 | 3.5 |
---|
>METH_HUMAN (Q99707) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent) (MS) Length = 1265 Score = 31.2 bits (69), Expect = 2.1 Identities = 19/74 (25%), Positives = 37/74 (50%) Frame = -1 Query: 294 HDVLVDQEL*AQGVGRREHFIFVANYILLPSQNK*IKNDLVFTKFSIKLSHF*FTYFGVE 115 +D++ D + G G EH ++ N+I K IK L + S LS+ F++ G+E Sbjct: 532 NDIIFDPNILTIGTGMEEHNLYAINFI---HATKVIKETLPGARISGGLSNLSFSFRGME 588 Query: 114 GVLHSNNFVIVLNS 73 + + + V + ++ Sbjct: 589 AIREAMHGVFLYHA 602
>ITCH_MOUSE (Q8C863) Itchy E3 ubiquitin protein ligase (EC 6.3.2.-)| Length = 864 Score = 30.4 bits (67), Expect = 3.5 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 246 FFQLLEPKAPDQPIHHDSVSDQPVILCIVQKVQLDHVPRQHLHYRHFRMDGTEIRCRFWV 425 FF+ P Q + + + V+LC +Q++ L+ R H YRH+ +I FW Sbjct: 718 FFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQR-HAIYRHYTRTSKQIMW-FWQ 775 Query: 426 F 428 F Sbjct: 776 F 776
>ITCH_HUMAN (Q96J02) Itchy homolog E3 ubiquitin protein ligase (EC 6.3.2.-)| (Itch) (Atrophin-1-interacting protein 4) (AIP4) (NFE2-associated polypeptide 1) (NAPP1) Length = 903 Score = 30.4 bits (67), Expect = 3.5 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 246 FFQLLEPKAPDQPIHHDSVSDQPVILCIVQKVQLDHVPRQHLHYRHFRMDGTEIRCRFWV 425 FF+ P Q + + + V+LC +Q++ L+ R H YRH+ +I FW Sbjct: 757 FFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQR-HAIYRHYARTSKQIMW-FWQ 814 Query: 426 F 428 F Sbjct: 815 F 815 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,319,555 Number of Sequences: 219361 Number of extensions: 1654035 Number of successful extensions: 3773 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3773 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)