Clone Name | rbasd23b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | THT1_SCHPO (Q09684) Nuclear fusion protein tht1 | 30 | 1.5 | 2 | URIC_DROPS (P22673) Uricase (EC 1.7.3.3) (Urate oxidase) | 28 | 5.8 | 3 | ENGC1_BACTN (Q8A5I9) Probable GTPase engC protein 1 (EC 3.6.1.-) | 27 | 9.9 |
---|
>THT1_SCHPO (Q09684) Nuclear fusion protein tht1| Length = 577 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 97 RGSVCICFPSIENHTYWYTSIASHYYSRTHLSXLS 201 RGS C +E+ + W+ S SH++ HL L+ Sbjct: 114 RGSQSECVSKLESTSTWWLSFTSHFHDVNHLCRLA 148
>URIC_DROPS (P22673) Uricase (EC 1.7.3.3) (Urate oxidase)| Length = 345 Score = 28.1 bits (61), Expect = 5.8 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = +1 Query: 10 KFXRXFEPYXXVPRYAHMRV---RIKCMINRGRGSVCICFPSIEN-----HTYWYTSIAS 165 K+ E + V Y RV K + N+G+GS C F SI+N H + +T A Sbjct: 117 KYSHVEEAHVHVETYPWQRVCQEETKSVNNQGQGS-CNNFTSIDNRSLHNHAFIFTPTAV 175 Query: 166 HY 171 HY Sbjct: 176 HY 177
>ENGC1_BACTN (Q8A5I9) Probable GTPase engC protein 1 (EC 3.6.1.-)| Length = 310 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 150 VPVRMIFDGREAYANAPPSSIDHALDTYTHVCVP 49 VPV+++F+ +AY +D ++ YTH+ P Sbjct: 119 VPVKLVFNKVDAYNEDELRYLDALINLYTHIGYP 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,459,334 Number of Sequences: 219361 Number of extensions: 596911 Number of successful extensions: 1110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1110 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)