Clone Name | rbasd23a16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NTNG1_HUMAN (Q9Y2I2) Netrin G1 precursor (Laminet-1) | 30 | 2.2 |
---|
>NTNG1_HUMAN (Q9Y2I2) Netrin G1 precursor (Laminet-1)| Length = 539 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 92 ENTHTCHPNLQSIPPVAYTGISDVRRRLTRAPS 190 +N TCH N++ + P AYTGI + R A S Sbjct: 475 QNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGS 507 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,453,036 Number of Sequences: 219361 Number of extensions: 516696 Number of successful extensions: 1335 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)