Clone Name | rbasd23a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PURK_HAEIN (P43850) Phosphoribosylaminoimidazole carboxylase ATP... | 30 | 4.1 | 2 | RCA_CUCSA (Q01587) Ribulose bisphosphate carboxylase/oxygenase a... | 29 | 6.9 |
---|
>PURK_HAEIN (P43850) Phosphoribosylaminoimidazole carboxylase ATPase subunit| (EC 4.1.1.21) (AIR carboxylase) (AIRC) Length = 362 Score = 29.6 bits (65), Expect = 4.1 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 6/85 (7%) Frame = -1 Query: 367 ERRTG*SGGHVLRRACVAEDVSRGKTSEDLQQQILGELFLPRSPSLGLL------LQRRF 206 +RRTG G+ R + D +R ++DL +++ E F+P + ++ ++RF Sbjct: 125 KRRTG---GYDGRGQWIIRDENRADITDDLFGEVIAEKFIPFDYEVSIVGARFKNGEKRF 181 Query: 205 LPRIHGETDRLSVLTRFKILPCAAP 131 P H + + + R+ ++ CA P Sbjct: 182 YPVTHNL--QQNGILRYSVVDCAFP 204
>RCA_CUCSA (Q01587) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 413 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 215 EKVSSANPWRNRSIVSSDEVQDIAL-RGSASCIYKEPLVAPTHTRKVS 75 EK + + WR + +SD+ QDI +G A +++ P+ TH +S Sbjct: 60 EKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLS 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,046,286 Number of Sequences: 219361 Number of extensions: 878642 Number of successful extensions: 2172 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2172 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)