Clone Name | rbasd22k01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATG8_LACBI (P87068) Autophagy-related protein 8 precursor (Autop... | 35 | 0.18 | 2 | KV3O_MOUSE (P01667) Ig kappa chain V-III region PC 6308 | 33 | 0.89 | 3 | KV3Q_MOUSE (P01669) Ig kappa chain V-III region PC 7769 | 32 | 1.2 | 4 | NCBP1_YEAST (P34160) Nuclear cap-binding protein complex subunit... | 29 | 9.9 |
---|
>ATG8_LACBI (P87068) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 184 Score = 35.0 bits (79), Expect = 0.18 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 206 WIQLRTSDEEKASSCVIANQQPW*WLSCTYNIDHVSCLYIM 84 W++L D +KA CV A ++ W W+ C + +C+ I+ Sbjct: 120 WVELPVDDMDKAFICVSAAKKHWVWVLCDVRSSYQNCVLIV 160
>KV3O_MOUSE (P01667) Ig kappa chain V-III region PC 6308| Length = 111 Score = 32.7 bits (73), Expect = 0.89 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = -3 Query: 311 WGQARPQGPTYRSV--ASTTASDPPARDSTLGSSTSCWIQLRTSDEEKASS--CVIANQQ 144 W Q +P P + AS S PAR S GS T + + +EE A++ C +N+ Sbjct: 39 WYQQKPGQPPKLLIYTASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNED 98 Query: 143 PW 138 PW Sbjct: 99 PW 100
>KV3Q_MOUSE (P01669) Ig kappa chain V-III region PC 7769| Length = 111 Score = 32.3 bits (72), Expect = 1.2 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = -3 Query: 311 WGQARPQGPTYRSV--ASTTASDPPARDSTLGSSTSCWIQLRTSDEEKASS--CVIANQQ 144 W Q +P P + AS S PAR S GS T + + +EE A++ C +N+ Sbjct: 39 WYQQKPGQPPKVLIFAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNED 98 Query: 143 PW 138 PW Sbjct: 99 PW 100
>NCBP1_YEAST (P34160) Nuclear cap-binding protein complex subunit 1 (Protein| GCR3) (Protein STO1) (Protein SUT1) Length = 861 Score = 29.3 bits (64), Expect = 9.9 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 6/86 (6%) Frame = +2 Query: 71 PVYRALCTNTTRDLCYTYMTTT------TKAADLL*HMS*LFLHQMYVVESSSLCLIREL 232 P+ A+ TNT ++ Y + TK +LL ++ Q Y+V+++ + L+RE Sbjct: 190 PLSEAIYTNTLLNIPYLFFFNRNNDGLRTKVEELL-----AYVEQNYLVKTTDINLLREY 244 Query: 233 NRGRVDQKPS*KPPNDMLALVDAPAP 310 N +PP +M+ LV P Sbjct: 245 NG---------EPPYEMVELVRVVLP 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,618,339 Number of Sequences: 219361 Number of extensions: 1312087 Number of successful extensions: 3192 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3191 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)