Clone Name | rbasd22i07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SRS1_ORYSA (P83649) Salt-stress root protein RS1 | 32 | 1.4 | 2 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 3.0 |
---|
>SRS1_ORYSA (P83649) Salt-stress root protein RS1| Length = 204 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 589 SGTTPLSPAIVFILDK 542 SGTTPLSPAI FIL+K Sbjct: 109 SGTTPLSPAIAFILEK 124
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 3.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 148 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 32 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,797,160 Number of Sequences: 219361 Number of extensions: 778064 Number of successful extensions: 1768 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)