Clone Name | rbasd22h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CD59_RAT (P27274) CD59 glycoprotein precursor (Membrane attack c... | 29 | 5.2 | 2 | BT2A1_HUMAN (Q7KYR7) Butyrophilin subfamily 2 member A1 precursor | 29 | 5.2 | 3 | NO12B_MEDSA (Q40339) Early nodulin 12B precursor (N-12B) | 28 | 8.9 |
---|
>CD59_RAT (P27274) CD59 glycoprotein precursor (Membrane attack complex| inhibition factor) (MACIF) (MAC-inhibitory protein) (MAC-IP) (Protectin) Length = 126 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 98 DACWVVPRKNNLISAGWNGSDCKAKVILSQL 6 DAC V + W SDC AK ILS+L Sbjct: 46 DACLVAVSGKQVYQQCWRFSDCNAKFILSRL 76
>BT2A1_HUMAN (Q7KYR7) Butyrophilin subfamily 2 member A1 precursor| Length = 528 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 36 VRSIPTSRDEIILPWNHPTRISQKIQTPPTKRPPHNQHLPA 158 + SIP S + PW+ ++PPHN HLPA Sbjct: 480 IESIPWSHSHVDKPWSF-------------QQPPHNTHLPA 507
>NO12B_MEDSA (Q40339) Early nodulin 12B precursor (N-12B)| Length = 113 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 75 PWNHPTRISQKIQTPPTKRPPHNQHLPA 158 P N P + + PP K PP ++H PA Sbjct: 80 PVNKPPQKESPVHKPPRKEPPTHKHPPA 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,409,882 Number of Sequences: 219361 Number of extensions: 716883 Number of successful extensions: 2719 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2716 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)