| Clone Name | rbasd22g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats pro... | 31 | 2.0 | 2 | RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats prote... | 30 | 4.4 | 3 | DPOG1_XENLA (Q91684) DNA polymerase gamma subunit 1 (EC 2.7.7.7)... | 29 | 7.5 | 4 | RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats pro... | 28 | 9.7 |
|---|
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 30.8 bits (68), Expect = 2.0 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Frame = -1 Query: 464 PFYCHPPPMQILPRENFAGSMPAFPMVGAQRQQV------RYSQSLHLTPSRVQPPQ 312 P HPPP+Q++P+ S PA P Q Q + + LH PS+ PQ Sbjct: 972 PPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQSLPPPAASHPTTGLHQVPSQSPFPQ 1028
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Frame = -1 Query: 464 PFYCHPPPMQILPRENFAGSMPAFPMVGAQRQQV-------RYSQSLHLTPSRVQPPQ 312 P HPPP+Q++P+ S PA P Q Q + + LH PS+ PQ Sbjct: 971 PPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQSLPPPAASHPTTGGLHQVPSQSPFPQ 1028
>DPOG1_XENLA (Q91684) DNA polymerase gamma subunit 1 (EC 2.7.7.7) (Mitochondrial| DNA polymerase catalytic subunit) Length = 1200 Score = 28.9 bits (63), Expect = 7.5 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 3/74 (4%) Frame = -2 Query: 481 AILGSGHFTAIHRRCKFCQGRILLDPCLLSPWLVLKGSKS---DIANPYISPRLVSSLHK 311 AILG HF IH C W+ L+G KS D+ + S +S H Sbjct: 870 AILGEAHFAGIH-------------GCTAFGWMTLQGKKSSGTDLHSKTASTVGISREH- 915 Query: 310 VT*TRMFTIRRIYG 269 ++F RIYG Sbjct: 916 ---AKVFNYGRIYG 926
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 28.5 bits (62), Expect = 9.7 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -1 Query: 464 PFYCHPPPMQILPRENFAGSMPAFPMVGAQRQQVRYSQSLHLTPSRVQPPQG 309 P HPPP+Q++P+ S PA P Q Q + P PP G Sbjct: 980 PPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQNLP-------PPPASHPPTG 1024 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,903,058 Number of Sequences: 219361 Number of extensions: 1603132 Number of successful extensions: 3334 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3334 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)