>HIS5_IDILO (Q5QWQ7) Imidazole glycerol phosphate synthase subunit hisH (EC|
           2.4.2.-) (IGP synthase glutamine amidotransferase
           subunit) (IGP synthase subunit hisH) (ImGP synthase
           subunit hisH) (IGPS subunit hisH)
          Length = 196

 Score = 28.1 bits (61), Expect = 7.1
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +3

Query: 12  KIILPIXGSYKXYWRTIERKCLMEPYRXL*FQPCSGI 122
           ++ILP  G+     R ++RK L+EP R L  QP  GI
Sbjct: 41  RVILPGVGTAAAAMRNLQRKQLVEPLREL-TQPVLGI 76


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,518,130
Number of Sequences: 219361
Number of extensions: 126057
Number of successful extensions: 113
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 113
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 113
length of database: 80,573,946
effective HSP length: 16
effective length of database: 77,064,170
effective search space used: 1849540080
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)