Clone Name | rbasd21m10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FUR2_DROME (P30432) Furin-like protease 2 precursor (EC 3.4.21.7... | 31 | 3.7 | 2 | YQJI_SHIFL (P64589) Hypothetical protein yqjI | 30 | 8.3 | 3 | YQJI_ECOLI (P64588) Hypothetical protein yqjI | 30 | 8.3 |
---|
>FUR2_DROME (P30432) Furin-like protease 2 precursor (EC 3.4.21.75) (Furin-2)| Length = 1679 Score = 30.8 bits (68), Expect = 3.7 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 256 RGPSLQFRC*ARRLQPLCY-RPPPTSS*NHVGLPWSCSPLC 375 RGP+ C RL C R PP S N VG+ W C C Sbjct: 979 RGPTQCVACSHYRLDNTCVSRCPPRSFPNQVGICWPCHDTC 1019
>YQJI_SHIFL (P64589) Hypothetical protein yqjI| Length = 207 Score = 29.6 bits (65), Expect = 8.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 587 HTEGCC*SWCPPRHVGCC 534 H EGCC PRH GCC Sbjct: 4 HHEGCCKHEGQPRHEGCC 21
>YQJI_ECOLI (P64588) Hypothetical protein yqjI| Length = 207 Score = 29.6 bits (65), Expect = 8.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 587 HTEGCC*SWCPPRHVGCC 534 H EGCC PRH GCC Sbjct: 4 HHEGCCKHEGQPRHEGCC 21 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,434,297 Number of Sequences: 219361 Number of extensions: 2472128 Number of successful extensions: 6629 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6629 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)